mRNA_L-elsbetiae_contig201.6037.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig201.6037.1 vs. uniprot
Match: D8LKP0_ECTSI (Uncharacterized protein (Fragment) n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LKP0_ECTSI) HSP 1 Score: 84.0 bits (206), Expect = 6.970e-16 Identity = 45/63 (71.43%), Postives = 50/63 (79.37%), Query Frame = 2 Query: 35 MDDLRAEGDFDDFAAAIGEGGDG-SDDDATSDDFLSWLLVHADTIDPKLNDLF---DNDEIAA 211 MDD+ E DFDDFAAA+GEGGDG S+DDA SDDFLSWLLVHAD+IDPKL D D E+AA Sbjct: 1 MDDILTEDDFDDFAAAVGEGGDGGSEDDARSDDFLSWLLVHADSIDPKLEDCVIGSDGSEVAA 63
BLAST of mRNA_L-elsbetiae_contig201.6037.1 vs. uniprot
Match: A0A6H5J8M8_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5J8M8_9PHAE) HSP 1 Score: 83.6 bits (205), Expect = 9.820e-16 Identity = 46/69 (66.67%), Postives = 56/69 (81.16%), Query Frame = 2 Query: 35 MDDLRAEGDFDDFAAAIGEGGDG-SDDDATSDDFLSWLLVHADTIDPKLND-LFDNDEIAAGSDLPLPA 235 MDD+ E DFDDFAAA+GEGGDG S+DDA SDDFLSWLL+HAD+IDPKL+D + D+D GS++ PA Sbjct: 1 MDDILTEDDFDDFAAAVGEGGDGGSEDDARSDDFLSWLLLHADSIDPKLDDCVIDSD----GSEVAAPA 65 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig201.6037.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig201.6037.1 >prot_L-elsbetiae_contig201.6037.1 ID=prot_L-elsbetiae_contig201.6037.1|Name=mRNA_L-elsbetiae_contig201.6037.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=150bp MMDDLRAEGDFDDFAAAIGEGGDGSDDDATSDDFLSWLLVHADTIDPKLNback to top mRNA from alignment at L-elsbetiae_contig201:45408..46462+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig201.6037.1 ID=mRNA_L-elsbetiae_contig201.6037.1|Name=mRNA_L-elsbetiae_contig201.6037.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=1055bp|location=Sequence derived from alignment at L-elsbetiae_contig201:45408..46462+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig201:45408..46462+ >mRNA_L-elsbetiae_contig201.6037.1 ID=mRNA_L-elsbetiae_contig201.6037.1|Name=mRNA_L-elsbetiae_contig201.6037.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=900bp|location=Sequence derived from alignment at L-elsbetiae_contig201:45408..46462+ (Laminarionema elsbetiae ELsaHSoW15)back to top |