mRNA_L-elsbetiae_contig1942.5762.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig1942.5762.1 vs. uniprot
Match: D7G2M4_ECTSI (Eukaryotic translation initiation factor 1-SUI1 n=2 Tax=Ectocarpus TaxID=2879 RepID=D7G2M4_ECTSI) HSP 1 Score: 55.1 bits (131), Expect = 6.580e-7 Identity = 25/27 (92.59%), Postives = 26/27 (96.30%), Query Frame = -2 Query: 3 SCNGAIVSDAEGGDIVQMSGDQRTNIH 83 SCNGAIVSD EGG+IVQMSGDQRTNIH Sbjct: 63 SCNGAIVSDTEGGEIVQMSGDQRTNIH 89 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig1942.5762.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig1942.5762.1 >prot_L-elsbetiae_contig1942.5762.1 ID=prot_L-elsbetiae_contig1942.5762.1|Name=mRNA_L-elsbetiae_contig1942.5762.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=104bp MATKIWGKRWYVCRSKYVVHGLLAVSSFQLLVMVTHQGSSSPACRLQRAGback to top mRNA from alignment at L-elsbetiae_contig1942:2166..2654+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig1942.5762.1 ID=mRNA_L-elsbetiae_contig1942.5762.1|Name=mRNA_L-elsbetiae_contig1942.5762.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=489bp|location=Sequence derived from alignment at L-elsbetiae_contig1942:2166..2654+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig1942:2166..2654+ >mRNA_L-elsbetiae_contig1942.5762.1 ID=mRNA_L-elsbetiae_contig1942.5762.1|Name=mRNA_L-elsbetiae_contig1942.5762.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=624bp|location=Sequence derived from alignment at L-elsbetiae_contig1942:2166..2654+ (Laminarionema elsbetiae ELsaHSoW15)back to top |