mRNA_L-elsbetiae_contig19167.5658.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig19167.5658.1 vs. uniprot
Match: A0A6H5JRZ0_9PHAE (GPS domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JRZ0_9PHAE) HSP 1 Score: 73.6 bits (179), Expect = 3.230e-14 Identity = 31/51 (60.78%), Postives = 40/51 (78.43%), Query Frame = 1 Query: 1 CVYWSETSNQWSVDGVALEGVSLELDGTSTITCRTFHLSPFAIADETSEAV 153 CVYWSE SN+W VDG+ L ++E+DGTS+ TC TFHLSPF IA+E S ++ Sbjct: 140 CVYWSEKSNEWEVDGIVLGHSTVEVDGTSSTTCWTFHLSPFGIAEEQSPSI 190
BLAST of mRNA_L-elsbetiae_contig19167.5658.1 vs. uniprot
Match: D7G0E1_ECTSI (GPS domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G0E1_ECTSI) HSP 1 Score: 68.6 bits (166), Expect = 3.180e-12 Identity = 30/51 (58.82%), Postives = 36/51 (70.59%), Query Frame = 1 Query: 1 CVYWSETSNQWSVDGVALEGVSLELDGTSTITCRTFHLSPFAIADETSEAV 153 C YWSE SN+W DG+ L + E+ G S+ITC TFHLSPFAIA E S +V Sbjct: 215 CAYWSEVSNEWKSDGIVLGSSTNEVGGASSITCSTFHLSPFAIAQEQSASV 265
BLAST of mRNA_L-elsbetiae_contig19167.5658.1 vs. uniprot
Match: D7G0E0_ECTSI (GPS domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G0E0_ECTSI) HSP 1 Score: 67.4 bits (163), Expect = 8.200e-12 Identity = 28/51 (54.90%), Postives = 37/51 (72.55%), Query Frame = 1 Query: 1 CVYWSETSNQWSVDGVALEGVSLELDGTSTITCRTFHLSPFAIADETSEAV 153 C YWSE SN+W DGV L ++++DGTS+I C TFHLSPFAI ++ S + Sbjct: 181 CGYWSEVSNEWKADGVVLGSANVKVDGTSSIICWTFHLSPFAITEKQSTPI 231 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig19167.5658.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig19167.5658.1 >prot_L-elsbetiae_contig19167.5658.1 ID=prot_L-elsbetiae_contig19167.5658.1|Name=mRNA_L-elsbetiae_contig19167.5658.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=51bp CVYWSETSNQWSVDGVALEGVSLELDGTSTITCRTFHLSPFAIADETSEAback to top mRNA from alignment at L-elsbetiae_contig19167:1361..1513+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig19167.5658.1 ID=mRNA_L-elsbetiae_contig19167.5658.1|Name=mRNA_L-elsbetiae_contig19167.5658.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=153bp|location=Sequence derived from alignment at L-elsbetiae_contig19167:1361..1513+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig19167:1361..1513+ >mRNA_L-elsbetiae_contig19167.5658.1 ID=mRNA_L-elsbetiae_contig19167.5658.1|Name=mRNA_L-elsbetiae_contig19167.5658.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=306bp|location=Sequence derived from alignment at L-elsbetiae_contig19167:1361..1513+ (Laminarionema elsbetiae ELsaHSoW15)back to top |