mRNA_L-elsbetiae_contig1895.5567.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig1895.5567.1 vs. uniprot
Match: A0A6H5JH57_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JH57_9PHAE) HSP 1 Score: 58.5 bits (140), Expect = 1.880e-7 Identity = 29/38 (76.32%), Postives = 31/38 (81.58%), Query Frame = 1 Query: 310 HLRNFAVSADERRQMEEDYRLALTMQRGGVAGAAGDRG 423 HLRNFAV+ADERRQMEEDYRLAL MQ+G A A G G Sbjct: 28 HLRNFAVTADERRQMEEDYRLALAMQKGEAAAANGTGG 65
BLAST of mRNA_L-elsbetiae_contig1895.5567.1 vs. uniprot
Match: D8LDG4_ECTSI (FYVE-type domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LDG4_ECTSI) HSP 1 Score: 56.6 bits (135), Expect = 1.410e-6 Identity = 28/35 (80.00%), Postives = 30/35 (85.71%), Query Frame = 1 Query: 310 HLRNFAVSADERRQMEEDYRLALTMQRGGVAGAAG 414 HLRNFAV+ADERRQMEEDYRLAL MQ+G A A G Sbjct: 378 HLRNFAVTADERRQMEEDYRLALAMQKGEAAVANG 412 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig1895.5567.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig1895.5567.1 >prot_L-elsbetiae_contig1895.5567.1 ID=prot_L-elsbetiae_contig1895.5567.1|Name=mRNA_L-elsbetiae_contig1895.5567.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=60bp MEMRGQEFTSPSSSWRRKYHLRNFAVSADERRQMEEDYRLALTMQRGGVAback to top mRNA from alignment at L-elsbetiae_contig1895:21326..21757+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig1895.5567.1 ID=mRNA_L-elsbetiae_contig1895.5567.1|Name=mRNA_L-elsbetiae_contig1895.5567.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=432bp|location=Sequence derived from alignment at L-elsbetiae_contig1895:21326..21757+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig1895:21326..21757+ >mRNA_L-elsbetiae_contig1895.5567.1 ID=mRNA_L-elsbetiae_contig1895.5567.1|Name=mRNA_L-elsbetiae_contig1895.5567.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=360bp|location=Sequence derived from alignment at L-elsbetiae_contig1895:21326..21757+ (Laminarionema elsbetiae ELsaHSoW15)back to top |