mRNA_L-elsbetiae_contig18750.5488.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig18750.5488.1 vs. uniprot
Match: D8LPZ2_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LPZ2_ECTSI) HSP 1 Score: 85.9 bits (211), Expect = 1.550e-18 Identity = 38/51 (74.51%), Postives = 42/51 (82.35%), Query Frame = 1 Query: 4 LLRAIRNKYLWLAVSLMFYTFGISGGVFDIIRKPPPFMLNKDGTFGWFHPQ 156 LLR IRNKYLWLA SL+ YTFGISGGV+DIIR P PFM+ +DG WFHPQ Sbjct: 237 LLRVIRNKYLWLATSLLVYTFGISGGVYDIIRNPAPFMVKQDGFIMWFHPQ 287
BLAST of mRNA_L-elsbetiae_contig18750.5488.1 vs. uniprot
Match: A0A485L545_9STRA (Aste57867_16045 protein n=1 Tax=Aphanomyces stellatus TaxID=120398 RepID=A0A485L545_9STRA) HSP 1 Score: 63.9 bits (154), Expect = 1.350e-10 Identity = 26/51 (50.98%), Postives = 35/51 (68.63%), Query Frame = 1 Query: 10 RAIRNKYLWLAVSLMFYTFGISGGVFDIIRKPPPFMLNKDGTFGWFHPQVR 162 R +R K LWL +S++F+ +SG V+ IIR+PPPF +DGT W HPQ R Sbjct: 212 RRLRRKQLWLVISILFFGLSVSGMVYCIIREPPPFAQERDGTLIWLHPQGR 262
BLAST of mRNA_L-elsbetiae_contig18750.5488.1 vs. uniprot
Match: A0A0P1AWF5_PLAHL (Magnesium transporter protein 1-like n=1 Tax=Plasmopara halstedii TaxID=4781 RepID=A0A0P1AWF5_PLAHL) HSP 1 Score: 61.6 bits (148), Expect = 9.570e-10 Identity = 27/54 (50.00%), Postives = 37/54 (68.52%), Query Frame = 1 Query: 1 VLLRAIRNKYLWLAVSLMFYTFGISGGVFDIIRKPPPFMLNKDGTFGWFHPQVR 162 ++L +R K LW+ VSL+FY +SG V+ IIRKPPPF ++ G +FHPQ R Sbjct: 232 LVLAKLRRKQLWMTVSLLFYGLSVSGMVYCIIRKPPPFASDRAGNIQYFHPQGR 285
BLAST of mRNA_L-elsbetiae_contig18750.5488.1 vs. uniprot
Match: A0A836CB15_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CB15_9STRA) HSP 1 Score: 57.8 bits (138), Expect = 1.270e-8 Identity = 24/41 (58.54%), Postives = 33/41 (80.49%), Query Frame = 1 Query: 1 VLLRAIRNKYLWLAVSLMFYTFGISGGVFDIIRKPPPFMLN 123 ++LR +R+ LWL VSL+ YTF ISG +FDIIR PPPF+++ Sbjct: 100 LVLRVVRSPTLWLVVSLLVYTFSISGAIFDIIRSPPPFVIS 140
BLAST of mRNA_L-elsbetiae_contig18750.5488.1 vs. uniprot
Match: A0A7S2UY50_9STRA (Hypothetical protein n=1 Tax=Fibrocapsa japonica TaxID=94617 RepID=A0A7S2UY50_9STRA) HSP 1 Score: 57.4 bits (137), Expect = 3.020e-8 Identity = 27/53 (50.94%), Postives = 35/53 (66.04%), Query Frame = 1 Query: 4 LLRAIRNKYLWLAVSLMFYTFGISGGVFDIIRKPPPFMLN-KDGTFGWFHPQV 159 ++ +RNK LWL VSL YT ISG ++DIIR P PF +N + G +FHPQ Sbjct: 218 IINLLRNKMLWLLVSLGMYTCSISGMIYDIIRNPAPFFMNHQTGQIVFFHPQA 270 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig18750.5488.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 5
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig18750.5488.1 >prot_L-elsbetiae_contig18750.5488.1 ID=prot_L-elsbetiae_contig18750.5488.1|Name=mRNA_L-elsbetiae_contig18750.5488.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=54bp VLLRAIRNKYLWLAVSLMFYTFGISGGVFDIIRKPPPFMLNKDGTFGWFHback to top mRNA from alignment at L-elsbetiae_contig18750:2630..2791- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig18750.5488.1 ID=mRNA_L-elsbetiae_contig18750.5488.1|Name=mRNA_L-elsbetiae_contig18750.5488.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=162bp|location=Sequence derived from alignment at L-elsbetiae_contig18750:2630..2791- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig18750:2630..2791- >mRNA_L-elsbetiae_contig18750.5488.1 ID=mRNA_L-elsbetiae_contig18750.5488.1|Name=mRNA_L-elsbetiae_contig18750.5488.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=324bp|location=Sequence derived from alignment at L-elsbetiae_contig18750:2630..2791- (Laminarionema elsbetiae ELsaHSoW15)back to top |