mRNA_L-elsbetiae_contig1805.5177.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig1805.5177.1 vs. uniprot
Match: A0A6H5JNT4_9PHAE (FSH1 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JNT4_9PHAE) HSP 1 Score: 65.1 bits (157), Expect = 9.440e-10 Identity = 27/28 (96.43%), Postives = 27/28 (96.43%), Query Frame = -1 Query: 295 RTWWRCDAEERKRAKAVPGMAGRCEWKV 378 RTWWRCD EERKRAKAVPGMAGRCEWKV Sbjct: 574 RTWWRCDPEERKRAKAVPGMAGRCEWKV 601
BLAST of mRNA_L-elsbetiae_contig1805.5177.1 vs. uniprot
Match: D8LNF9_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LNF9_ECTSI) HSP 1 Score: 63.5 bits (153), Expect = 3.330e-9 Identity = 26/27 (96.30%), Postives = 26/27 (96.30%), Query Frame = -1 Query: 298 RTWWRCDAEERKRAKAVPGMAGRCEWK 378 RTWWRCD EERKRAKAVPGMAGRCEWK Sbjct: 567 RTWWRCDPEERKRAKAVPGMAGRCEWK 593 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig1805.5177.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig1805.5177.1 >prot_L-elsbetiae_contig1805.5177.1 ID=prot_L-elsbetiae_contig1805.5177.1|Name=mRNA_L-elsbetiae_contig1805.5177.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=126bp STPCSGIREYNIKSRIVRRGWMGEAVGLCYANIGWCLVYRWLVDCLFGSAback to top mRNA from alignment at L-elsbetiae_contig1805:11658..12037+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig1805.5177.1 ID=mRNA_L-elsbetiae_contig1805.5177.1|Name=mRNA_L-elsbetiae_contig1805.5177.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=380bp|location=Sequence derived from alignment at L-elsbetiae_contig1805:11658..12037+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig1805:11658..12037+ >mRNA_L-elsbetiae_contig1805.5177.1 ID=mRNA_L-elsbetiae_contig1805.5177.1|Name=mRNA_L-elsbetiae_contig1805.5177.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=756bp|location=Sequence derived from alignment at L-elsbetiae_contig1805:11658..12037+ (Laminarionema elsbetiae ELsaHSoW15)back to top |