mRNA_L-elsbetiae_contig17991.5149.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig17991.5149.1 vs. uniprot
Match: D7G985_ECTSI (EsV-1-7 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G985_ECTSI) HSP 1 Score: 54.3 bits (129), Expect = 8.280e-6 Identity = 21/35 (60.00%), Postives = 24/35 (68.57%), Query Frame = 2 Query: 5 KRCAHRGCSKHPTYGVQGSKAREFCADHKMEDMVN 109 KRC H GC K P+YG GSK REFCA H + MV+ Sbjct: 7 KRCGHLGCMKRPSYGTDGSKKREFCAQHSQQGMVS 41
BLAST of mRNA_L-elsbetiae_contig17991.5149.1 vs. uniprot
Match: D7FUJ6_ECTSI (EsV-1-7 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FUJ6_ECTSI) HSP 1 Score: 50.8 bits (120), Expect = 2.440e-5 Identity = 20/35 (57.14%), Postives = 24/35 (68.57%), Query Frame = 2 Query: 2 SKRCAHRGCSKHPTYGVQGSKAREFCADHKMEDMV 106 SKRC H GC+K P+YG GSK E CA H ++ MV Sbjct: 6 SKRCGHPGCTKRPSYGNDGSKKAELCAQHALQGMV 40
BLAST of mRNA_L-elsbetiae_contig17991.5149.1 vs. uniprot
Match: A0A6H5JT00_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JT00_9PHAE) HSP 1 Score: 52.8 bits (125), Expect = 3.260e-5 Identity = 20/33 (60.61%), Postives = 23/33 (69.70%), Query Frame = 2 Query: 11 CAHRGCSKHPTYGVQGSKAREFCADHKMEDMVN 109 C H C+K PTYGV GSK REFC+ H + MVN Sbjct: 64 CGHENCTKRPTYGVAGSKKREFCSQHARDGMVN 96
BLAST of mRNA_L-elsbetiae_contig17991.5149.1 vs. uniprot
Match: D7FI73_ECTSI (EsV-1-7 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FI73_ECTSI) HSP 1 Score: 52.4 bits (124), Expect = 4.110e-5 Identity = 20/33 (60.61%), Postives = 23/33 (69.70%), Query Frame = 2 Query: 11 CAHRGCSKHPTYGVQGSKAREFCADHKMEDMVN 109 C H C+K PTYGV GSK REFC+ H + MVN Sbjct: 4 CGHANCTKRPTYGVAGSKKREFCSQHARDGMVN 36
BLAST of mRNA_L-elsbetiae_contig17991.5149.1 vs. uniprot
Match: D8LCI2_ECTSI (EsV-1-7 n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LCI2_ECTSI) HSP 1 Score: 51.2 bits (121), Expect = 8.110e-5 Identity = 21/37 (56.76%), Postives = 25/37 (67.57%), Query Frame = 2 Query: 8 RCAHRGCSKHPTYGVQGSKAREFCADHKMEDMVNPRS 118 RC H GC KH +YGV+G+K REFC H MV+ RS Sbjct: 5 RCGHPGCGKHSSYGVKGTKEREFCGRHAKMGMVDVRS 41 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig17991.5149.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 5
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig17991.5149.1 >prot_L-elsbetiae_contig17991.5149.1 ID=prot_L-elsbetiae_contig17991.5149.1|Name=mRNA_L-elsbetiae_contig17991.5149.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=96bp MEDMVNPRSAHALGGGTGSDEGVGSAASFAGVCVGEERECKERVLSASERback to top mRNA from alignment at L-elsbetiae_contig17991:1146..2193+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig17991.5149.1 ID=mRNA_L-elsbetiae_contig17991.5149.1|Name=mRNA_L-elsbetiae_contig17991.5149.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=1048bp|location=Sequence derived from alignment at L-elsbetiae_contig17991:1146..2193+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig17991:1146..2193+ >mRNA_L-elsbetiae_contig17991.5149.1 ID=mRNA_L-elsbetiae_contig17991.5149.1|Name=mRNA_L-elsbetiae_contig17991.5149.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=576bp|location=Sequence derived from alignment at L-elsbetiae_contig17991:1146..2193+ (Laminarionema elsbetiae ELsaHSoW15)back to top |