mRNA_L-elsbetiae_contig17429.4893.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig17429.4893.1 vs. uniprot
Match: A0A6H5KIA7_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KIA7_9PHAE) HSP 1 Score: 58.9 bits (141), Expect = 2.740e-8 Identity = 29/80 (36.25%), Postives = 50/80 (62.50%), Query Frame = 1 Query: 4 THVITSGGGYLSIPDDKLDEFEKQYATEILHANRSVTLSELPSDPVFPMFFKINHLDRDGLTNEGMQEICTVVVGVLSRY 243 TH + +GG + +P ++ DEF + YATE+ N++++ SEL S+P F M+F I+ LD L+ E I +++ GV+ + Sbjct: 20 THTLMTGG-VVGVPHEQYDEFLRLYATEVESKNKTISFSELRSNPAFCMYFDIDLLDSKELSTEVGLRIYSLIQGVVRSF 98
BLAST of mRNA_L-elsbetiae_contig17429.4893.1 vs. uniprot
Match: D8LP78_ECTSI (EsV-1-45 n=2 Tax=root TaxID=1 RepID=D8LP78_ECTSI) HSP 1 Score: 57.4 bits (137), Expect = 9.550e-8 Identity = 28/73 (38.36%), Postives = 43/73 (58.90%), Query Frame = 1 Query: 25 GGYLSIPDDKLDEFEKQYATEILHANRSVTLSELPSDPVFPMFFKINHLDRDGLTNEGMQEICTVVVGVLSRY 243 GG +S+PD+ DEF + YA E+ N++++ SEL SDPVF M+F ++ L L I +V+ V+ Y Sbjct: 25 GGVVSVPDENYDEFLQLYAEEVRSKNKTLSFSELRSDPVFCMYFDVDMLGTGVLGAAESSRIFSVIQSVIRSY 97 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig17429.4893.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig17429.4893.1 >prot_L-elsbetiae_contig17429.4893.1 ID=prot_L-elsbetiae_contig17429.4893.1|Name=mRNA_L-elsbetiae_contig17429.4893.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=81bp ITHVITSGGGYLSIPDDKLDEFEKQYATEILHANRSVTLSELPSDPVFPMback to top mRNA from alignment at L-elsbetiae_contig17429:2679..2921- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig17429.4893.1 ID=mRNA_L-elsbetiae_contig17429.4893.1|Name=mRNA_L-elsbetiae_contig17429.4893.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=243bp|location=Sequence derived from alignment at L-elsbetiae_contig17429:2679..2921- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig17429:2679..2921- >mRNA_L-elsbetiae_contig17429.4893.1 ID=mRNA_L-elsbetiae_contig17429.4893.1|Name=mRNA_L-elsbetiae_contig17429.4893.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=486bp|location=Sequence derived from alignment at L-elsbetiae_contig17429:2679..2921- (Laminarionema elsbetiae ELsaHSoW15)back to top |