mRNA_L-elsbetiae_contig1733.4846.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig1733.4846.1 vs. uniprot
Match: D7G1K5_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G1K5_ECTSI) HSP 1 Score: 56.2 bits (134), Expect = 1.740e-6 Identity = 27/34 (79.41%), Postives = 30/34 (88.24%), Query Frame = -3 Query: 82 MGAVMVDDPALVLFAGGIGMEGTVVDANVDAFAV 183 MGAVMVDDPA++LFAGGIG G VVD+NVD FAV Sbjct: 1 MGAVMVDDPAVILFAGGIGRGGMVVDSNVDVFAV 34 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig1733.4846.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig1733.4846.1 >prot_L-elsbetiae_contig1733.4846.1 ID=prot_L-elsbetiae_contig1733.4846.1|Name=mRNA_L-elsbetiae_contig1733.4846.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=106bp LLHQHVASLASVGAPAAVGLLESLCLPNCEGIDVCIDHRSFHAYTSRKQNback to top mRNA from alignment at L-elsbetiae_contig1733:6816..7243+ Legend: CDSpolypeptideUTR Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig1733.4846.1 ID=mRNA_L-elsbetiae_contig1733.4846.1|Name=mRNA_L-elsbetiae_contig1733.4846.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=428bp|location=Sequence derived from alignment at L-elsbetiae_contig1733:6816..7243+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig1733:6816..7243+ >mRNA_L-elsbetiae_contig1733.4846.1 ID=mRNA_L-elsbetiae_contig1733.4846.1|Name=mRNA_L-elsbetiae_contig1733.4846.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=636bp|location=Sequence derived from alignment at L-elsbetiae_contig1733:6816..7243+ (Laminarionema elsbetiae ELsaHSoW15)back to top |