mRNA_L-elsbetiae_contig17234.4801.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig17234.4801.1 vs. uniprot
Match: A0A6H5KIJ4_9PHAE (MazG domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KIJ4_9PHAE) HSP 1 Score: 74.3 bits (181), Expect = 3.240e-14 Identity = 37/59 (62.71%), Postives = 45/59 (76.27%), Query Frame = 1 Query: 19 RSEKDKVANSLVQCFTVVLLLAERCNIDLPLSVQLKMKLNAKKYPVLIAKGSALKYDAY 195 R+EKD V + +LLLAERCN+DL LSV LK+KLNAKKYP ++ +GSALKYDAY Sbjct: 82 RTEKDVVVLEMGSAAACLLLLAERCNVDLGLSVDLKVKLNAKKYPAVLVRGSALKYDAY 140
BLAST of mRNA_L-elsbetiae_contig17234.4801.1 vs. uniprot
Match: D7FVS0_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FVS0_ECTSI) HSP 1 Score: 72.4 bits (176), Expect = 3.960e-14 Identity = 38/65 (58.46%), Postives = 45/65 (69.23%), Query Frame = 1 Query: 1 GCETLGRSEKDKVANSLVQCFTVVLLLAERCNIDLPLSVQLKMKLNAKKYPVLIAKGSALKYDAY 195 G R EKD V L +LLLAE+CN+DL LSV LK+KLNAKKYP ++ +GSALKYDAY Sbjct: 32 GLPRFTRPEKDVVVLELGSAAGCLLLLAEQCNVDLGLSVDLKIKLNAKKYPAVLVRGSALKYDAY 96
BLAST of mRNA_L-elsbetiae_contig17234.4801.1 vs. uniprot
Match: A0A7M7JJN7_VARDE (dCTP pyrophosphatase 1 n=1 Tax=Varroa destructor TaxID=109461 RepID=A0A7M7JJN7_VARDE) HSP 1 Score: 51.6 bits (122), Expect = 1.420e-6 Identity = 26/63 (41.27%), Postives = 36/63 (57.14%), Query Frame = 1 Query: 1 GCETLGRSEKDKVANSLVQCFTVVLLLAERCNIDLPLSVQLKMKLNAKKYPVLIAKGSALKYD 189 G L EK + L ++ LAERC +DLP+ K+K NA+KYPV +AKG + K+D Sbjct: 74 GVPELSSDEKTHLGEELSDVLLYLIRLAERCEVDLPMEALRKLKKNAEKYPVSLAKGRSGKHD 136
BLAST of mRNA_L-elsbetiae_contig17234.4801.1 vs. uniprot
Match: A0A7R8XGZ9_9CRUS (dCTP pyrophosphatase 1 n=1 Tax=Darwinula stevensoni TaxID=69355 RepID=A0A7R8XGZ9_9CRUS) HSP 1 Score: 48.1 bits (113), Expect = 3.920e-5 Identity = 23/57 (40.35%), Postives = 35/57 (61.40%), Query Frame = 1 Query: 25 EKDKVANSLVQCFTVVLLLAERCNIDLPLSVQLKMKLNAKKYPVLIAKGSALKYDAY 195 +K++V + +++LA+RC IDLP ++ KM LNA KYP KG + KY+ Y Sbjct: 98 DKERVGEEMSDILIYLVMLADRCRIDLPKAITEKMNLNALKYPRDKVKGDSRKYNEY 154
BLAST of mRNA_L-elsbetiae_contig17234.4801.1 vs. uniprot
Match: UPI001AE053B9 (nucleotide pyrophosphohydrolase n=1 Tax=Rhodoferax sp. AJA081-3 TaxID=2752316 RepID=UPI001AE053B9) HSP 1 Score: 47.0 bits (110), Expect = 5.800e-5 Identity = 25/60 (41.67%), Postives = 36/60 (60.00%), Query Frame = 1 Query: 7 ETLGRSEKDKVANSLVQCFTVVLLLAERCNIDLPLSVQLKMKLNAKKYPVLIAKGSALKY 186 + L +KD+VA F +L L ++ IDL + Q KM +NA+KYPV A+G+A KY Sbjct: 54 QALSPDKKDEVAAEAADVFLYLLQLCDKLGIDLVAAAQAKMLVNAQKYPVDAARGTATKY 113
BLAST of mRNA_L-elsbetiae_contig17234.4801.1 vs. uniprot
Match: UPI00040F7343 (nucleotide pyrophosphohydrolase n=1 Tax=Methylocaldum szegediense TaxID=73780 RepID=UPI00040F7343) HSP 1 Score: 47.0 bits (110), Expect = 6.010e-5 Identity = 25/57 (43.86%), Postives = 43/57 (75.44%), Query Frame = 1 Query: 19 RSEKDKVANSLVQCFTVVLLLAERCNIDLPLSVQLKMKLNAKKYPVLIAKGSALKYD 189 R+ +++VA+ L+ +L LA++ NIDL +V+ KM+ NA+KYPV +A+G+A+KY+ Sbjct: 62 RAVREEVADVLIY----LLRLADQLNIDLDAAVEEKMRKNAEKYPVELARGNAVKYN 114 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig17234.4801.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 6
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig17234.4801.1 >prot_L-elsbetiae_contig17234.4801.1 ID=prot_L-elsbetiae_contig17234.4801.1|Name=mRNA_L-elsbetiae_contig17234.4801.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=65bp GCETLGRSEKDKVANSLVQCFTVVLLLAERCNIDLPLSVQLKMKLNAKKYback to top mRNA from alignment at L-elsbetiae_contig17234:1504..1698- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig17234.4801.1 ID=mRNA_L-elsbetiae_contig17234.4801.1|Name=mRNA_L-elsbetiae_contig17234.4801.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=195bp|location=Sequence derived from alignment at L-elsbetiae_contig17234:1504..1698- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig17234:1504..1698- >mRNA_L-elsbetiae_contig17234.4801.1 ID=mRNA_L-elsbetiae_contig17234.4801.1|Name=mRNA_L-elsbetiae_contig17234.4801.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=390bp|location=Sequence derived from alignment at L-elsbetiae_contig17234:1504..1698- (Laminarionema elsbetiae ELsaHSoW15)back to top |