mRNA_L-elsbetiae_contig16344.4318.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig16344.4318.1 vs. uniprot
Match: A0A6H5KZ19_9PHAE (RING-type domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=A0A6H5KZ19_9PHAE) HSP 1 Score: 55.5 bits (132), Expect = 7.400e-8 Identity = 18/25 (72.00%), Postives = 21/25 (84.00%), Query Frame = 1 Query: 31 WTCPICLNWFDMPVSPPCGHSFCAG 105 W+CP+C WFDMPV PPC H+FCAG Sbjct: 29 WSCPVCFMWFDMPVFPPCQHTFCAG 53
BLAST of mRNA_L-elsbetiae_contig16344.4318.1 vs. uniprot
Match: A0A8C5AB53_GADMO (zf-RING_UBOX domain-containing protein n=1 Tax=Gadus morhua TaxID=8049 RepID=A0A8C5AB53_GADMO) HSP 1 Score: 47.4 bits (111), Expect = 3.330e-6 Identity = 17/26 (65.38%), Postives = 22/26 (84.62%), Query Frame = 1 Query: 22 EANWTCPICLNWFDMPVSPPCGHSFC 99 E N++CPICL+ F+ PVS PCGH+FC Sbjct: 10 EENFSCPICLDVFNSPVSTPCGHNFC 35
BLAST of mRNA_L-elsbetiae_contig16344.4318.1 vs. uniprot
Match: A0A8C5ASR7_GADMO (Uncharacterized protein n=3 Tax=Gadus morhua TaxID=8049 RepID=A0A8C5ASR7_GADMO) HSP 1 Score: 48.9 bits (115), Expect = 1.520e-5 Identity = 18/32 (56.25%), Postives = 24/32 (75.00%), Query Frame = 1 Query: 4 STAEEQEANWTCPICLNWFDMPVSPPCGHSFC 99 +T E N++CPICL+ F+ PVS PCGH+FC Sbjct: 271 ATTSGSEENFSCPICLDVFNSPVSTPCGHNFC 302
BLAST of mRNA_L-elsbetiae_contig16344.4318.1 vs. uniprot
Match: A0A8C4ZUT0_GADMO (Uncharacterized protein n=2 Tax=Gadus morhua TaxID=8049 RepID=A0A8C4ZUT0_GADMO) HSP 1 Score: 48.9 bits (115), Expect = 1.520e-5 Identity = 18/32 (56.25%), Postives = 24/32 (75.00%), Query Frame = 1 Query: 4 STAEEQEANWTCPICLNWFDMPVSPPCGHSFC 99 +T E N++CPICL+ F+ PVS PCGH+FC Sbjct: 4 ATTSGSEENFSCPICLDVFNSPVSTPCGHNFC 35
BLAST of mRNA_L-elsbetiae_contig16344.4318.1 vs. uniprot
Match: UPI0011B813A6 (E3 ubiquitin-protein ligase TRIM47-like isoform X2 n=1 Tax=Gadus morhua TaxID=8049 RepID=UPI0011B813A6) HSP 1 Score: 48.9 bits (115), Expect = 1.530e-5 Identity = 18/32 (56.25%), Postives = 24/32 (75.00%), Query Frame = 1 Query: 4 STAEEQEANWTCPICLNWFDMPVSPPCGHSFC 99 +T E N++CPICL+ F+ PVS PCGH+FC Sbjct: 19 ATTSGSEENFSCPICLDVFNSPVSTPCGHNFC 50
BLAST of mRNA_L-elsbetiae_contig16344.4318.1 vs. uniprot
Match: A0A8C4ZYA1_GADMO (Uncharacterized protein n=2 Tax=Gadus morhua TaxID=8049 RepID=A0A8C4ZYA1_GADMO) HSP 1 Score: 48.1 bits (113), Expect = 2.840e-5 Identity = 18/32 (56.25%), Postives = 24/32 (75.00%), Query Frame = 1 Query: 4 STAEEQEANWTCPICLNWFDMPVSPPCGHSFC 99 S + E N++CPICL+ F+ PVS PCGH+FC Sbjct: 41 SNSSWSEENFSCPICLDVFNSPVSTPCGHNFC 72
BLAST of mRNA_L-elsbetiae_contig16344.4318.1 vs. uniprot
Match: A0A087XY97_POEFO (E3 ubiquitin-protein ligase TRIM21-like n=10 Tax=Poeciliinae TaxID=586240 RepID=A0A087XY97_POEFO) HSP 1 Score: 47.4 bits (111), Expect = 5.330e-5 Identity = 20/33 (60.61%), Postives = 23/33 (69.70%), Query Frame = 1 Query: 1 LSTAEEQEANWTCPICLNWFDMPVSPPCGHSFC 99 LS+A E +TC ICL F+ PVS PCGHSFC Sbjct: 3 LSSAFLSEDQFTCSICLEMFNNPVSTPCGHSFC 35
BLAST of mRNA_L-elsbetiae_contig16344.4318.1 vs. uniprot
Match: A0A8C5B4R7_GADMO (Uncharacterized protein n=1 Tax=Gadus morhua TaxID=8049 RepID=A0A8C5B4R7_GADMO) HSP 1 Score: 47.4 bits (111), Expect = 5.330e-5 Identity = 17/26 (65.38%), Postives = 22/26 (84.62%), Query Frame = 1 Query: 22 EANWTCPICLNWFDMPVSPPCGHSFC 99 E N++CPICL+ F+ PVS PCGH+FC Sbjct: 41 EENFSCPICLDVFNSPVSTPCGHNFC 66
BLAST of mRNA_L-elsbetiae_contig16344.4318.1 vs. uniprot
Match: UPI0011B61885 (E3 ubiquitin-protein ligase TRIM39-like n=1 Tax=Gadus morhua TaxID=8049 RepID=UPI0011B61885) HSP 1 Score: 47.4 bits (111), Expect = 5.330e-5 Identity = 17/26 (65.38%), Postives = 22/26 (84.62%), Query Frame = 1 Query: 22 EANWTCPICLNWFDMPVSPPCGHSFC 99 E N++CPICL+ F+ PVS PCGH+FC Sbjct: 10 EENFSCPICLDVFNSPVSTPCGHNFC 35
BLAST of mRNA_L-elsbetiae_contig16344.4318.1 vs. uniprot
Match: UPI0011B84FE6 (E3 ubiquitin-protein ligase TRIM47-like n=1 Tax=Gadus morhua TaxID=8049 RepID=UPI0011B84FE6) HSP 1 Score: 47.4 bits (111), Expect = 5.350e-5 Identity = 17/26 (65.38%), Postives = 22/26 (84.62%), Query Frame = 1 Query: 22 EANWTCPICLNWFDMPVSPPCGHSFC 99 E N++CPICL+ F+ PVS PCGH+FC Sbjct: 10 EENFSCPICLDVFNSPVSTPCGHNFC 35 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig16344.4318.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 13
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig16344.4318.1 >prot_L-elsbetiae_contig16344.4318.1 ID=prot_L-elsbetiae_contig16344.4318.1|Name=mRNA_L-elsbetiae_contig16344.4318.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=38bp LSTAEEQEANWTCPICLNWFDMPVSPPCGHSFCAGVS*back to top mRNA from alignment at L-elsbetiae_contig16344:327..440- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig16344.4318.1 ID=mRNA_L-elsbetiae_contig16344.4318.1|Name=mRNA_L-elsbetiae_contig16344.4318.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=114bp|location=Sequence derived from alignment at L-elsbetiae_contig16344:327..440- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig16344:327..440- >mRNA_L-elsbetiae_contig16344.4318.1 ID=mRNA_L-elsbetiae_contig16344.4318.1|Name=mRNA_L-elsbetiae_contig16344.4318.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=228bp|location=Sequence derived from alignment at L-elsbetiae_contig16344:327..440- (Laminarionema elsbetiae ELsaHSoW15)back to top |