mRNA_L-elsbetiae_contig1557.3910.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig1557.3910.1 vs. uniprot
Match: A0A6H5JH46_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JH46_9PHAE) HSP 1 Score: 60.8 bits (146), Expect = 8.940e-9 Identity = 33/82 (40.24%), Postives = 48/82 (58.54%), Query Frame = 2 Query: 53 MLMLCSVLGASHSLI----VSPGGELKGPRAVISFAEHQTTDDRRTYLQGAQEQGYTCWVFPNYHSAAV---CIQNPGSIYS 277 +L+L LG S I ++P +G R V F E+QTT+DRR+YLQ A+EQGYTC + + + AV C + P + Y+ Sbjct: 10 ILLLIISLGQSRGNIDVRFIAPSAAFEGERFVSFFREYQTTEDRRSYLQAAREQGYTCSMLEHNYQEAVGLFCAKTPTTTYT 91 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig1557.3910.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig1557.3910.1 >prot_L-elsbetiae_contig1557.3910.1 ID=prot_L-elsbetiae_contig1557.3910.1|Name=mRNA_L-elsbetiae_contig1557.3910.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=84bp MVPFSGNLCMLMLCSVLGASHSLIVSPGGELKGPRAVISFAEHQTTDDRRback to top mRNA from alignment at L-elsbetiae_contig1557:20498..21004+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig1557.3910.1 ID=mRNA_L-elsbetiae_contig1557.3910.1|Name=mRNA_L-elsbetiae_contig1557.3910.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=507bp|location=Sequence derived from alignment at L-elsbetiae_contig1557:20498..21004+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig1557:20498..21004+ >mRNA_L-elsbetiae_contig1557.3910.1 ID=mRNA_L-elsbetiae_contig1557.3910.1|Name=mRNA_L-elsbetiae_contig1557.3910.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=504bp|location=Sequence derived from alignment at L-elsbetiae_contig1557:20498..21004+ (Laminarionema elsbetiae ELsaHSoW15)back to top |