mRNA_L-elsbetiae_contig15161.3690.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig15161.3690.1 vs. uniprot
Match: A0A6H5J9H9_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5J9H9_9PHAE) HSP 1 Score: 112 bits (281), Expect = 8.410e-28 Identity = 47/50 (94.00%), Postives = 48/50 (96.00%), Query Frame = 1 Query: 1 IPMQNLTAPGDWNRQKGALKHFNWSEGCFNFHFIDQDTTDGGASDWEDFQ 150 IPMQNLTAPGDWNRQ GALKHFNWSEGCFNFHFIDQDTTDGG SDWED+Q Sbjct: 46 IPMQNLTAPGDWNRQNGALKHFNWSEGCFNFHFIDQDTTDGGLSDWEDYQ 95
BLAST of mRNA_L-elsbetiae_contig15161.3690.1 vs. uniprot
Match: D8LGF8_ECTSI (OSJNBa0029H02.30 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LGF8_ECTSI) HSP 1 Score: 110 bits (275), Expect = 2.600e-27 Identity = 46/50 (92.00%), Postives = 47/50 (94.00%), Query Frame = 1 Query: 1 IPMQNLTAPGDWNRQKGALKHFNWSEGCFNFHFIDQDTTDGGASDWEDFQ 150 IPMQNLTAPGDWNRQ ALKHFNWSEGCFNFHFIDQDTTDGG SDWED+Q Sbjct: 46 IPMQNLTAPGDWNRQNSALKHFNWSEGCFNFHFIDQDTTDGGLSDWEDYQ 95
BLAST of mRNA_L-elsbetiae_contig15161.3690.1 vs. uniprot
Match: A0A835ZHG4_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZHG4_9STRA) HSP 1 Score: 80.9 bits (198), Expect = 1.100e-16 Identity = 30/50 (60.00%), Postives = 40/50 (80.00%), Query Frame = 1 Query: 1 IPMQNLTAPGDWNRQKGALKHFNWSEGCFNFHFIDQDTTDGGASDWEDFQ 150 +PMQ+LTAPGDW RQ +HF+W+EG F+FHF++ TTDGG S+W D+Q Sbjct: 44 VPMQDLTAPGDWTRQNCPFRHFSWTEGAFHFHFVEDGTTDGGLSEWGDYQ 93 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig15161.3690.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig15161.3690.1 >prot_L-elsbetiae_contig15161.3690.1 ID=prot_L-elsbetiae_contig15161.3690.1|Name=mRNA_L-elsbetiae_contig15161.3690.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=48bp MQNLTAPGDWNRQKGALKHFNWSEGCFNFHFIDQDTTDGGASDWEDFQback to top mRNA from alignment at L-elsbetiae_contig15161:82..231- Legend: UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig15161.3690.1 ID=mRNA_L-elsbetiae_contig15161.3690.1|Name=mRNA_L-elsbetiae_contig15161.3690.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=150bp|location=Sequence derived from alignment at L-elsbetiae_contig15161:82..231- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig15161:82..231- >mRNA_L-elsbetiae_contig15161.3690.1 ID=mRNA_L-elsbetiae_contig15161.3690.1|Name=mRNA_L-elsbetiae_contig15161.3690.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=288bp|location=Sequence derived from alignment at L-elsbetiae_contig15161:82..231- (Laminarionema elsbetiae ELsaHSoW15)back to top |