mRNA_L-elsbetiae_contig15057.3629.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig15057.3629.1 vs. uniprot
Match: A0A6H5KWE3_9PHAE (GCFC domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KWE3_9PHAE) HSP 1 Score: 112 bits (281), Expect = 1.590e-27 Identity = 57/64 (89.06%), Postives = 61/64 (95.31%), Query Frame = 1 Query: 7 QAFRTLREKFPEEYAVFGLAQLVPAMAAPVIKRSLAGWSPLGAPAQPASLLASWKDVLTDTSGA 198 +AFRTLRE+FPEEYAVFGLAQLVPAMAAPV+KRSLAGWSPL AP +PA LLASWKDVLTDTSGA Sbjct: 191 KAFRTLRERFPEEYAVFGLAQLVPAMAAPVLKRSLAGWSPLQAPTEPARLLASWKDVLTDTSGA 254
BLAST of mRNA_L-elsbetiae_contig15057.3629.1 vs. uniprot
Match: D8LQD4_ECTSI (G-patch domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LQD4_ECTSI) HSP 1 Score: 112 bits (281), Expect = 1.690e-27 Identity = 57/64 (89.06%), Postives = 61/64 (95.31%), Query Frame = 1 Query: 7 QAFRTLREKFPEEYAVFGLAQLVPAMAAPVIKRSLAGWSPLGAPAQPASLLASWKDVLTDTSGA 198 +AFRTLRE+FPEEYAVFGLAQLVPAMAAPV+KRSLAGWSPL AP +PA LLASWKDVLTDTSGA Sbjct: 621 KAFRTLRERFPEEYAVFGLAQLVPAMAAPVLKRSLAGWSPLQAPTEPARLLASWKDVLTDTSGA 684
BLAST of mRNA_L-elsbetiae_contig15057.3629.1 vs. uniprot
Match: A0A7S2STN5_9STRA (Hypothetical protein (Fragment) n=1 Tax=Rhizochromulina marina TaxID=1034831 RepID=A0A7S2STN5_9STRA) HSP 1 Score: 57.8 bits (138), Expect = 3.890e-8 Identity = 31/64 (48.44%), Postives = 46/64 (71.88%), Query Frame = 1 Query: 1 LSQAFRTLR-EKFPEEYAVFGLAQLVPAMAAPVIKRSLAGWSPLGAPAQPASLLASWKDVLTDT 189 L +A R LR ++ EE+A+FGLAQLVP + APVI+ +LA W PL P + A++LA+W+ ++ T Sbjct: 448 LLEALRDLRADERAEEFAMFGLAQLVPGLMAPVIEDALADWDPLSHPTRGAAVLAAWRPLVART 511
BLAST of mRNA_L-elsbetiae_contig15057.3629.1 vs. uniprot
Match: A0A369RVN8_9METZ (Tuftelin-interacting protein 11 n=1 Tax=Trichoplax sp. H2 TaxID=287889 RepID=A0A369RVN8_9METZ) HSP 1 Score: 52.4 bits (124), Expect = 3.070e-6 Identity = 26/63 (41.27%), Postives = 37/63 (58.73%), Query Frame = 1 Query: 4 SQAFRTLREKFPEEYAVFGLAQLVPAMAAPVIKRSLAGWSPLGAPAQPASLLASWKDVLTDTS 192 S F+ L++ FP+EY ++GLA L A+ P+IK+ L GW PL P W +LTD+S Sbjct: 123 SSTFQKLQQNFPDEYKMYGLADLAVAIVYPLIKQYLRGWMPLQDPTFSLKTFIEWNALLTDSS 185
BLAST of mRNA_L-elsbetiae_contig15057.3629.1 vs. uniprot
Match: A0A834KD79_VESVU (G-patch domain-containing protein n=11 Tax=Vespidae TaxID=7438 RepID=A0A834KD79_VESVU) HSP 1 Score: 50.1 bits (118), Expect = 2.040e-5 Identity = 23/59 (38.98%), Postives = 35/59 (59.32%), Query Frame = 1 Query: 4 SQAFRTLREKFPEEYAVFGLAQLVPAMAAPVIKRSLAGWSPLGAPAQPASLLASWKDVL 180 + F++L++K+ EEY ++ L L + P IK SL W+PL P QP L WK++L Sbjct: 380 ADVFKSLQDKYYEEYKMYELGDLATSFVGPKIKDSLLSWNPLMQPKQPIKLFEQWKEIL 438
BLAST of mRNA_L-elsbetiae_contig15057.3629.1 vs. uniprot
Match: A0A150H3B5_GONPE (G-patch domain-containing protein n=1 Tax=Gonium pectorale TaxID=33097 RepID=A0A150H3B5_GONPE) HSP 1 Score: 49.3 bits (116), Expect = 3.820e-5 Identity = 28/66 (42.42%), Postives = 40/66 (60.61%), Query Frame = 1 Query: 1 LSQAFRTLREKFPEEYAVFGLAQLVPAMAAPVIKRSLAGWSPLGAPAQPASLLASWKDVLT-DTSG 195 L+ + LRE++ EEY ++GLAQ A A P ++ L GW PL P++ A L W+ +LT D SG Sbjct: 461 LAAQYGKLRERYREEYIMYGLAQAALAQALPRLQALLRGWQPLAEPSRGAEELRIWRQLLTQDGSG 526
BLAST of mRNA_L-elsbetiae_contig15057.3629.1 vs. uniprot
Match: A0A835XZY6_9CHLO (G-patch domain-containing protein n=1 Tax=Edaphochlamys debaryana TaxID=47281 RepID=A0A835XZY6_9CHLO) HSP 1 Score: 48.1 bits (113), Expect = 9.800e-5 Identity = 24/65 (36.92%), Postives = 39/65 (60.00%), Query Frame = 1 Query: 1 LSQAFRTLREKFPEEYAVFGLAQLVPAMAAPVIKRSLAGWSPLGAPAQPASLLASWKDVLTDTSG 195 L+ A+ +R++F EEY ++G+AQ A A P ++ L GW PL P + + + +WK +L SG Sbjct: 522 LAAAYGAIRDRFREEYIMYGIAQAALAQALPRMQALLRGWQPLQEPTRGTAEMRTWKALLQGESG 586 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig15057.3629.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 7
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig15057.3629.1 >prot_L-elsbetiae_contig15057.3629.1 ID=prot_L-elsbetiae_contig15057.3629.1|Name=mRNA_L-elsbetiae_contig15057.3629.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=66bp LSQAFRTLREKFPEEYAVFGLAQLVPAMAAPVIKRSLAGWSPLGAPAQPAback to top mRNA from alignment at L-elsbetiae_contig15057:3563..3760+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig15057.3629.1 ID=mRNA_L-elsbetiae_contig15057.3629.1|Name=mRNA_L-elsbetiae_contig15057.3629.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=198bp|location=Sequence derived from alignment at L-elsbetiae_contig15057:3563..3760+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig15057:3563..3760+ >mRNA_L-elsbetiae_contig15057.3629.1 ID=mRNA_L-elsbetiae_contig15057.3629.1|Name=mRNA_L-elsbetiae_contig15057.3629.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=396bp|location=Sequence derived from alignment at L-elsbetiae_contig15057:3563..3760+ (Laminarionema elsbetiae ELsaHSoW15)back to top |