mRNA_L-elsbetiae_contig14733.3443.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig14733.3443.1 vs. uniprot
Match: D8LTR1_ECTSI (Kinesin light chain-like protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LTR1_ECTSI) HSP 1 Score: 79.0 bits (193), Expect = 1.580e-14 Identity = 39/49 (79.59%), Postives = 44/49 (89.80%), Query Frame = 1 Query: 1 AVGRAEAELGEEHPKVATLLFLLSRMVQERGVYDEAEELCTRALNIYEA 147 A+ RAE E+G EHP+VATLLFLLSR+VQERG Y EAEELCTRAL+IYEA Sbjct: 312 ALVRAEGEVGGEHPRVATLLFLLSRIVQERGDYTEAEELCTRALSIYEA 360
BLAST of mRNA_L-elsbetiae_contig14733.3443.1 vs. uniprot
Match: A0A431L2N7_9BACT (Tetratricopeptide repeat protein n=1 Tax=Candidatus Melainabacteria bacterium TaxID=2052166 RepID=A0A431L2N7_9BACT) HSP 1 Score: 52.0 bits (123), Expect = 3.900e-5 Identity = 26/68 (38.24%), Postives = 38/68 (55.88%), Query Frame = 1 Query: 10 RAEAELGEEHPKVATLLFLLSRMVQERGVYDEAEELCTRALNIYEAALGPEHPDVGVALNCLAMSWQA 213 RA + P++A+ L L S ++ + G EA+ +C R L YE+ L P H D+GV N LAM + A Sbjct: 289 RATETFDQLDPRIASTLELYSEVLWKNGKLAEAQPVCERTLQFYESTLPPNHQDIGVIANNLAMLYHA 356
BLAST of mRNA_L-elsbetiae_contig14733.3443.1 vs. uniprot
Match: A0A431L0X8_9BACT (Tetratricopeptide repeat protein n=1 Tax=Candidatus Melainabacteria bacterium TaxID=2052166 RepID=A0A431L0X8_9BACT) HSP 1 Score: 51.2 bits (121), Expect = 7.020e-5 Identity = 25/56 (44.64%), Postives = 37/56 (66.07%), Query Frame = 1 Query: 34 EHPKVATLLFLLSRMVQERGVYDEAEELCTRALNIYEAALGPEHPDVGVALNCLAM 201 + P+++ L L+ + ++ YD+AE LC R L I+E+ LGP+H DV VA N LAM Sbjct: 306 DDPRLSLTLESLAEVYWKQLKYDKAEPLCKRLLQIWESVLGPDHADVAVAANNLAM 361 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig14733.3443.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig14733.3443.1 >prot_L-elsbetiae_contig14733.3443.1 ID=prot_L-elsbetiae_contig14733.3443.1|Name=mRNA_L-elsbetiae_contig14733.3443.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=130bp AVGRAEAELGEEHPKVATLLFLLSRMVQERGVYDEAEELCTRALNIYEAAback to top mRNA from alignment at L-elsbetiae_contig14733:180..955- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig14733.3443.1 ID=mRNA_L-elsbetiae_contig14733.3443.1|Name=mRNA_L-elsbetiae_contig14733.3443.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=776bp|location=Sequence derived from alignment at L-elsbetiae_contig14733:180..955- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig14733:180..955- >mRNA_L-elsbetiae_contig14733.3443.1 ID=mRNA_L-elsbetiae_contig14733.3443.1|Name=mRNA_L-elsbetiae_contig14733.3443.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=780bp|location=Sequence derived from alignment at L-elsbetiae_contig14733:180..955- (Laminarionema elsbetiae ELsaHSoW15)back to top |