mRNA_L-elsbetiae_contig14725.3434.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig14725.3434.1 vs. uniprot
Match: A0A6H5JH57_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JH57_9PHAE) HSP 1 Score: 53.9 bits (128), Expect = 1.680e-5 Identity = 26/38 (68.42%), Postives = 29/38 (76.32%), Query Frame = 1 Query: 133 HLSNLAVSADQRRQMEEDYRLALTMQRGGVAGAAGDRG 246 HL N AV+AD+RRQMEEDYRLAL MQ+G A A G G Sbjct: 28 HLRNFAVTADERRQMEEDYRLALAMQKGEAAAANGTGG 65 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig14725.3434.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig14725.3434.1 >prot_L-elsbetiae_contig14725.3434.1 ID=prot_L-elsbetiae_contig14725.3434.1|Name=mRNA_L-elsbetiae_contig14725.3434.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=60bp MEMRGKEFTSPSSSRRRKYHLSNLAVSADQRRQMEEDYRLALTMQRGGVAback to top mRNA from alignment at L-elsbetiae_contig14725:132..652+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig14725.3434.1 ID=mRNA_L-elsbetiae_contig14725.3434.1|Name=mRNA_L-elsbetiae_contig14725.3434.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=521bp|location=Sequence derived from alignment at L-elsbetiae_contig14725:132..652+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig14725:132..652+ >mRNA_L-elsbetiae_contig14725.3434.1 ID=mRNA_L-elsbetiae_contig14725.3434.1|Name=mRNA_L-elsbetiae_contig14725.3434.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=360bp|location=Sequence derived from alignment at L-elsbetiae_contig14725:132..652+ (Laminarionema elsbetiae ELsaHSoW15)back to top |