mRNA_L-elsbetiae_contig13769.2858.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig13769.2858.1 vs. uniprot
Match: A0A6H5L6Q9_9PHAE (Protein xylosyltransferase n=2 Tax=Ectocarpus TaxID=2879 RepID=A0A6H5L6Q9_9PHAE) HSP 1 Score: 62.0 bits (149), Expect = 3.320e-10 Identity = 25/36 (69.44%), Postives = 29/36 (80.56%), Query Frame = 1 Query: 1 QAIYDPSNFYLVHLDRKDTQDVRRDLESFIGGWSNV 108 +AIYDP+NFYLVHLDRKD +RRD E+FI W NV Sbjct: 196 KAIYDPNNFYLVHLDRKDKHSIRRDFENFIEEWDNV 231
BLAST of mRNA_L-elsbetiae_contig13769.2858.1 vs. uniprot
Match: UPI001FD6B0E1 (beta-1,6-N-acetylglucosaminyltransferase n=2 Tax=Chryseobacterium TaxID=59732 RepID=UPI001FD6B0E1) HSP 1 Score: 48.9 bits (115), Expect = 1.380e-5 Identity = 17/36 (47.22%), Postives = 29/36 (80.56%), Query Frame = 1 Query: 1 QAIYDPSNFYLVHLDRKDTQDVRRDLESFIGGWSNV 108 +AIY+ +NFYL+H+D+K TQ++ +D+ SF+ + NV Sbjct: 42 KAIYESTNFYLIHIDKKATQEINKDVRSFLEQYPNV 77
BLAST of mRNA_L-elsbetiae_contig13769.2858.1 vs. uniprot
Match: A0A086BLZ3_9FLAO (Glycosyl transferase n=2 Tax=Chryseobacterium piperi TaxID=558152 RepID=A0A086BLZ3_9FLAO) HSP 1 Score: 47.4 bits (111), Expect = 4.830e-5 Identity = 15/36 (41.67%), Postives = 28/36 (77.78%), Query Frame = 1 Query: 1 QAIYDPSNFYLVHLDRKDTQDVRRDLESFIGGWSNV 108 +AIY+P+NFYL+H+D+K Q++ +D+ F+ + N+ Sbjct: 28 KAIYEPTNFYLIHIDKKANQEIGKDVRDFLKKYPNI 63
BLAST of mRNA_L-elsbetiae_contig13769.2858.1 vs. uniprot
Match: UPI001E3BEF94 (beta-1,6-N-acetylglucosaminyltransferase n=1 Tax=Chryseobacterium soli TaxID=445961 RepID=UPI001E3BEF94) HSP 1 Score: 47.4 bits (111), Expect = 4.860e-5 Identity = 16/36 (44.44%), Postives = 29/36 (80.56%), Query Frame = 1 Query: 1 QAIYDPSNFYLVHLDRKDTQDVRRDLESFIGGWSNV 108 QAIY+P +FYL+H+D+K +Q++ ++ SF+ ++NV Sbjct: 42 QAIYEPDHFYLIHIDKKASQEIGEEVSSFLEKYTNV 77
BLAST of mRNA_L-elsbetiae_contig13769.2858.1 vs. uniprot
Match: UPI001BEA58E1 (beta-1,6-N-acetylglucosaminyltransferase n=1 Tax=Chryseobacterium sp. ISL-6 TaxID=2819143 RepID=UPI001BEA58E1) HSP 1 Score: 47.0 bits (110), Expect = 6.650e-5 Identity = 16/36 (44.44%), Postives = 28/36 (77.78%), Query Frame = 1 Query: 1 QAIYDPSNFYLVHLDRKDTQDVRRDLESFIGGWSNV 108 +AIY+PSNFYL+H+D+K Q++ +++ F+ + NV Sbjct: 41 KAIYEPSNFYLIHIDKKANQEIGEEVKDFLKEYPNV 76
BLAST of mRNA_L-elsbetiae_contig13769.2858.1 vs. uniprot
Match: A0A2X2XPZ3_9FLAO (Core-2/I-Branching enzyme n=13 Tax=Chryseobacterium TaxID=59732 RepID=A0A2X2XPZ3_9FLAO) HSP 1 Score: 46.6 bits (109), Expect = 9.100e-5 Identity = 16/36 (44.44%), Postives = 28/36 (77.78%), Query Frame = 1 Query: 1 QAIYDPSNFYLVHLDRKDTQDVRRDLESFIGGWSNV 108 +AIYD +NFYL+H+D+K Q++ +D++ F+ + NV Sbjct: 42 KAIYDSTNFYLIHIDKKANQEIGKDVKDFLKQYPNV 77
BLAST of mRNA_L-elsbetiae_contig13769.2858.1 vs. uniprot
Match: A0A511Y5Z0_9FLAO (Glycosyl transferase n=2 Tax=Chryseobacterium lathyri TaxID=395933 RepID=A0A511Y5Z0_9FLAO) HSP 1 Score: 46.6 bits (109), Expect = 9.100e-5 Identity = 16/36 (44.44%), Postives = 27/36 (75.00%), Query Frame = 1 Query: 1 QAIYDPSNFYLVHLDRKDTQDVRRDLESFIGGWSNV 108 +A+YDPSNFYL+H+D+K Q++ ++ F+ + NV Sbjct: 42 KALYDPSNFYLIHIDKKANQEIGEEVSVFLQKYPNV 77 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig13769.2858.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 7
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig13769.2858.1 >prot_L-elsbetiae_contig13769.2858.1 ID=prot_L-elsbetiae_contig13769.2858.1|Name=mRNA_L-elsbetiae_contig13769.2858.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=36bp QAIYDPSNFYLVHLDRKDTQDVRRDLESFIGGWSNVback to top mRNA from alignment at L-elsbetiae_contig13769:4776..4883+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig13769.2858.1 ID=mRNA_L-elsbetiae_contig13769.2858.1|Name=mRNA_L-elsbetiae_contig13769.2858.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=108bp|location=Sequence derived from alignment at L-elsbetiae_contig13769:4776..4883+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig13769:4776..4883+ >mRNA_L-elsbetiae_contig13769.2858.1 ID=mRNA_L-elsbetiae_contig13769.2858.1|Name=mRNA_L-elsbetiae_contig13769.2858.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=216bp|location=Sequence derived from alignment at L-elsbetiae_contig13769:4776..4883+ (Laminarionema elsbetiae ELsaHSoW15)back to top |