mRNA_L-elsbetiae_contig13700.2826.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig13700.2826.1 vs. uniprot
Match: A0A6H5KDJ4_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KDJ4_9PHAE) HSP 1 Score: 59.7 bits (143), Expect = 2.790e-8 Identity = 31/91 (34.07%), Postives = 49/91 (53.85%), Query Frame = 1 Query: 1 GATSDGLHAVAYQSATFILSDTQFDRLAKIVGVEGKDRTAKKSRLKGKMRHQTWRGILTGAGLTPPPACVWNLLLRRSETMISSMETHYPW 273 G ++ HA+ + I+SD Q + ++ GV + K+ + +++ WR L A L P C WN++LRRS TM++SME H PW Sbjct: 44 GVDAEDRHALQFLDGFLIVSDHQLEVMSASFGVGSGTHSGIKAGFRKAFKNR-WRHYLATANLDLAPPCAWNMVLRRSPTMMNSMEAHTPW 133
BLAST of mRNA_L-elsbetiae_contig13700.2826.1 vs. uniprot
Match: A0A6H5JA60_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JA60_9PHAE) HSP 1 Score: 58.5 bits (140), Expect = 8.710e-8 Identity = 32/94 (34.04%), Postives = 50/94 (53.19%), Query Frame = 1 Query: 1 GATSDGLHAVAYQSATFILSDTQFDRLAKIVGVEGKDRTAKKSRLKGKMRHQTWRGI---LTGAGLTPPPACVWNLLLRRSETMISSMETHYPW 273 GA D L+ + + +LS Q + LA G+ D + + + K R + R + + G+ + PP C WN+LLRRS +MI+S+E H PW Sbjct: 282 GAEVDRLYPLKFSDGNLVLSSQQLEALAIQTGIP--DTSLAEMAVAVKERWSSLRRLSQAIAGSAVVPPETCAWNMLLRRSPSMIASLEAHNPW 373
BLAST of mRNA_L-elsbetiae_contig13700.2826.1 vs. uniprot
Match: D7G5J4_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G5J4_ECTSI) HSP 1 Score: 49.7 bits (117), Expect = 4.080e-5 Identity = 20/38 (52.63%), Postives = 24/38 (63.16%), Query Frame = 1 Query: 160 WRGILTGAGLTPPPACVWNLLLRRSETMISSMETHYPW 273 WR A L P C WN++LRRS TM++SME H PW Sbjct: 27 WRHYFAMANLDLAPPCAWNMVLRRSPTMMNSMEAHTPW 64 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig13700.2826.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig13700.2826.1 >prot_L-elsbetiae_contig13700.2826.1 ID=prot_L-elsbetiae_contig13700.2826.1|Name=mRNA_L-elsbetiae_contig13700.2826.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=104bp GATSDGLHAVAYQSATFILSDTQFDRLAKIVGVEGKDRTAKKSRLKGKMRback to top mRNA from alignment at L-elsbetiae_contig13700:1784..2813+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig13700.2826.1 ID=mRNA_L-elsbetiae_contig13700.2826.1|Name=mRNA_L-elsbetiae_contig13700.2826.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=1030bp|location=Sequence derived from alignment at L-elsbetiae_contig13700:1784..2813+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig13700:1784..2813+ >mRNA_L-elsbetiae_contig13700.2826.1 ID=mRNA_L-elsbetiae_contig13700.2826.1|Name=mRNA_L-elsbetiae_contig13700.2826.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=624bp|location=Sequence derived from alignment at L-elsbetiae_contig13700:1784..2813+ (Laminarionema elsbetiae ELsaHSoW15)back to top |