mRNA_L-elsbetiae_contig13663.2788.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig13663.2788.1 vs. uniprot
Match: A0A6H5JHG5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JHG5_9PHAE) HSP 1 Score: 59.7 bits (143), Expect = 1.080e-6 Identity = 29/37 (78.38%), Postives = 31/37 (83.78%), Query Frame = 3 Query: 588 RLLLAVWLKKRPGLLEKRVDVRFALKCQEFIELVKKG 698 R A+ K+RPGLLEKR DVRFALKCQEFIELVKKG Sbjct: 691 RAATAMLQKERPGLLEKRADVRFALKCQEFIELVKKG 727
BLAST of mRNA_L-elsbetiae_contig13663.2788.1 vs. uniprot
Match: D8LQC3_ECTSI (CTLH domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LQC3_ECTSI) HSP 1 Score: 57.4 bits (137), Expect = 5.200e-6 Identity = 26/29 (89.66%), Postives = 28/29 (96.55%), Query Frame = 3 Query: 612 KKRPGLLEKRVDVRFALKCQEFIELVKKG 698 ++RPGLLEKR DVRFALKCQEFIELVKKG Sbjct: 57 RERPGLLEKRADVRFALKCQEFIELVKKG 85 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig13663.2788.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig13663.2788.1 >prot_L-elsbetiae_contig13663.2788.1 ID=prot_L-elsbetiae_contig13663.2788.1|Name=mRNA_L-elsbetiae_contig13663.2788.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=135bp RGHRSAKERGGQTPGGLKSWFDARAACFSVFGAVDAGRPAVAGTEAEEFVback to top mRNA from alignment at L-elsbetiae_contig13663:3602..4300+ Legend: CDSpolypeptideUTR Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig13663.2788.1 ID=mRNA_L-elsbetiae_contig13663.2788.1|Name=mRNA_L-elsbetiae_contig13663.2788.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=699bp|location=Sequence derived from alignment at L-elsbetiae_contig13663:3602..4300+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig13663:3602..4300+ >mRNA_L-elsbetiae_contig13663.2788.1 ID=mRNA_L-elsbetiae_contig13663.2788.1|Name=mRNA_L-elsbetiae_contig13663.2788.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=810bp|location=Sequence derived from alignment at L-elsbetiae_contig13663:3602..4300+ (Laminarionema elsbetiae ELsaHSoW15)back to top |