mRNA_L-elsbetiae_contig13656.2780.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig13656.2780.1 vs. uniprot
Match: D7FV08_ECTSI (FeS_assembly_P domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FV08_ECTSI) HSP 1 Score: 64.3 bits (155), Expect = 5.680e-12 Identity = 35/45 (77.78%), Postives = 35/45 (77.78%), Query Frame = 1 Query: 1 RFMPATTVRISAVNKQLGDKERVAAALENAHLMAVVNKCTSPAAA 135 R P T AVNKQLGDKERVAAALEN HLMAVVNKCTS AAA Sbjct: 72 RIAPGTHSSEEAVNKQLGDKERVAAALENQHLMAVVNKCTSTAAA 116
BLAST of mRNA_L-elsbetiae_contig13656.2780.1 vs. uniprot
Match: B7PEZ3_IXOSC (FeS_assembly_P domain-containing protein n=6 Tax=Ixodes TaxID=6944 RepID=B7PEZ3_IXOSC) HSP 1 Score: 55.5 bits (132), Expect = 6.650e-9 Identity = 27/42 (64.29%), Postives = 32/42 (76.19%), Query Frame = 1 Query: 1 RFMPATTVRISAVNKQLGDKERVAAALENAHLMAVVNKCTSP 126 R +P T V A+NKQL DKERVAAALEN+HL+ VVN+C P Sbjct: 41 RILPGTHVSEVAINKQLDDKERVAAALENSHLLQVVNRCLVP 82
BLAST of mRNA_L-elsbetiae_contig13656.2780.1 vs. uniprot
Match: UPI001896D78A (cytosolic iron-sulfur assembly component 2B-like n=1 Tax=Dermacentor silvarum TaxID=543639 RepID=UPI001896D78A) HSP 1 Score: 56.2 bits (134), Expect = 1.170e-8 Identity = 27/39 (69.23%), Postives = 32/39 (82.05%), Query Frame = 1 Query: 1 RFMPATTVRISAVNKQLGDKERVAAALENAHLMAVVNKC 117 R +P T V SA+NKQL DKERVAAALEN+HL+ VVN+C Sbjct: 100 RILPGTHVSESAINKQLDDKERVAAALENSHLLQVVNRC 138
BLAST of mRNA_L-elsbetiae_contig13656.2780.1 vs. uniprot
Match: A0A418B6Y3_9STRA (FeS_assembly_P domain-containing protein n=1 Tax=Aphanomyces invadans TaxID=157072 RepID=A0A418B6Y3_9STRA) HSP 1 Score: 55.5 bits (132), Expect = 1.490e-8 Identity = 27/39 (69.23%), Postives = 30/39 (76.92%), Query Frame = 1 Query: 1 RFMPATTVRISAVNKQLGDKERVAAALENAHLMAVVNKC 117 R P T + A+NKQL DKERVAAALENAHL+ VVNKC Sbjct: 75 RITPGTHITEDAINKQLNDKERVAAALENAHLLNVVNKC 113
BLAST of mRNA_L-elsbetiae_contig13656.2780.1 vs. uniprot
Match: A0A1Z5L725_ORNMO (FeS_assembly_P domain-containing protein (Fragment) n=2 Tax=Ornithodoros TaxID=6937 RepID=A0A1Z5L725_ORNMO) HSP 1 Score: 55.8 bits (133), Expect = 2.080e-8 Identity = 27/41 (65.85%), Postives = 32/41 (78.05%), Query Frame = 1 Query: 1 RFMPATTVRISAVNKQLGDKERVAAALENAHLMAVVNKCTS 123 + P T +A+NKQL DKERVAAALEN+HL+AVVNKC S Sbjct: 115 KITPGTHASEAAINKQLSDKERVAAALENSHLLAVVNKCLS 155
BLAST of mRNA_L-elsbetiae_contig13656.2780.1 vs. uniprot
Match: A0A485LGM1_9STRA (Aste57867_21091 protein n=1 Tax=Aphanomyces stellatus TaxID=120398 RepID=A0A485LGM1_9STRA) HSP 1 Score: 55.5 bits (132), Expect = 2.830e-8 Identity = 27/39 (69.23%), Postives = 30/39 (76.92%), Query Frame = 1 Query: 1 RFMPATTVRISAVNKQLGDKERVAAALENAHLMAVVNKC 117 R P T + A+NKQL DKERVAAALENAHL+ VVNKC Sbjct: 109 RITPGTHITEDAINKQLNDKERVAAALENAHLLNVVNKC 147
BLAST of mRNA_L-elsbetiae_contig13656.2780.1 vs. uniprot
Match: A0A067D6V7_SAPPC (FeS_assembly_P domain-containing protein n=3 Tax=Saprolegniaceae TaxID=4764 RepID=A0A067D6V7_SAPPC) HSP 1 Score: 55.5 bits (132), Expect = 3.020e-8 Identity = 27/39 (69.23%), Postives = 30/39 (76.92%), Query Frame = 1 Query: 1 RFMPATTVRISAVNKQLGDKERVAAALENAHLMAVVNKC 117 R P T + A+NKQL DKERVAAALENAHL+ VVNKC Sbjct: 113 RITPGTHITEDAINKQLNDKERVAAALENAHLLNVVNKC 151
BLAST of mRNA_L-elsbetiae_contig13656.2780.1 vs. uniprot
Match: A0A3R7M3C3_PENVA (FeS_assembly_P domain-containing protein n=3 Tax=Penaeus TaxID=133894 RepID=A0A3R7M3C3_PENVA) HSP 1 Score: 55.5 bits (132), Expect = 3.020e-8 Identity = 26/42 (61.90%), Postives = 31/42 (73.81%), Query Frame = 1 Query: 1 RFMPATTVRISAVNKQLGDKERVAAALENAHLMAVVNKCTSP 126 R P T A+NKQL DKERVAAALEN+HL+ V+NKC +P Sbjct: 115 RISPGTHASEHAINKQLNDKERVAAALENSHLLEVINKCLNP 156
BLAST of mRNA_L-elsbetiae_contig13656.2780.1 vs. uniprot
Match: A0A6G0XVQ6_9STRA (FeS_assembly_P domain-containing protein n=1 Tax=Aphanomyces euteiches TaxID=100861 RepID=A0A6G0XVQ6_9STRA) HSP 1 Score: 55.5 bits (132), Expect = 3.120e-8 Identity = 27/39 (69.23%), Postives = 30/39 (76.92%), Query Frame = 1 Query: 1 RFMPATTVRISAVNKQLGDKERVAAALENAHLMAVVNKC 117 R P T + A+NKQL DKERVAAALENAHL+ VVNKC Sbjct: 115 RITPGTHITEDAINKQLNDKERVAAALENAHLLNVVNKC 153
BLAST of mRNA_L-elsbetiae_contig13656.2780.1 vs. uniprot
Match: A0A835CRM0_9HYME (FeS_assembly_P domain-containing protein n=1 Tax=Aphidius gifuensis TaxID=684658 RepID=A0A835CRM0_9HYME) HSP 1 Score: 54.7 bits (130), Expect = 5.880e-8 Identity = 27/38 (71.05%), Postives = 31/38 (81.58%), Query Frame = 1 Query: 10 PATTVRISAVNKQLGDKERVAAALENAHLMAVVNKCTS 123 P T V AVNKQL DKERVAAALEN+HL+AV+N+C S Sbjct: 116 PGTHVSEQAVNKQLADKERVAAALENSHLVAVINQCVS 153 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig13656.2780.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig13656.2780.1 >prot_L-elsbetiae_contig13656.2780.1 ID=prot_L-elsbetiae_contig13656.2780.1|Name=mRNA_L-elsbetiae_contig13656.2780.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=45bp MPATTVRISAVNKQLGDKERVAAALENAHLMAVVNKCTSPAAAE*back to top mRNA from alignment at L-elsbetiae_contig13656:521..661- Legend: UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig13656.2780.1 ID=mRNA_L-elsbetiae_contig13656.2780.1|Name=mRNA_L-elsbetiae_contig13656.2780.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=141bp|location=Sequence derived from alignment at L-elsbetiae_contig13656:521..661- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig13656:521..661- >mRNA_L-elsbetiae_contig13656.2780.1 ID=mRNA_L-elsbetiae_contig13656.2780.1|Name=mRNA_L-elsbetiae_contig13656.2780.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=270bp|location=Sequence derived from alignment at L-elsbetiae_contig13656:521..661- (Laminarionema elsbetiae ELsaHSoW15)back to top |