mRNA_L-elsbetiae_contig134.2617.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig134.2617.1 vs. uniprot
Match: D7G4X8_ECTSI (EsV-1-7 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G4X8_ECTSI) HSP 1 Score: 76.6 bits (187), Expect = 4.820e-14 Identity = 36/74 (48.65%), Postives = 50/74 (67.57%), Query Frame = 2 Query: 29 CTRHGCTKQPSFGIAGSKAE*CRDHAKGGMVNVFNNKCTFPGCTTIASYGEESSGTRKFCARHAEEGMVHLSGR 250 CT +GCT++P+ G+AG KAE C H+ VNV + +C+ GC+T A YG S R+F ++HA EGMV+LS R Sbjct: 50 CTLYGCTRKPTHGVAGKKAEFCARHSLATSVNV-SQECSIDGCSTRAHYGVAGSKKREFXSKHALEGMVNLSNR 122
BLAST of mRNA_L-elsbetiae_contig134.2617.1 vs. uniprot
Match: A0A836CAB2_9STRA (Uncharacterized protein (Fragment) n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CAB2_9STRA) HSP 1 Score: 53.9 bits (128), Expect = 9.200e-7 Identity = 23/50 (46.00%), Postives = 33/50 (66.00%), Query Frame = 2 Query: 92 CRDHAKGGMVNVFNNKCTFPGCTTIASYGEESSGTRKFCARHAEEGMVHL 241 C+ HA G +++ + C PGCTT A YG S+G ++ CARH E+GMV + Sbjct: 16 CKQHAPPGTRSLYRS-CEAPGCTTHAYYGYVSTGVKRSCARHKEDGMVFI 64
BLAST of mRNA_L-elsbetiae_contig134.2617.1 vs. uniprot
Match: A0A6G8MZ28_9VIRU (Uncharacterized protein n=1 Tax=Cedratvirus kamchatka TaxID=2716914 RepID=A0A6G8MZ28_9VIRU) HSP 1 Score: 55.5 bits (132), Expect = 1.280e-6 Identity = 27/74 (36.49%), Postives = 37/74 (50.00%), Query Frame = 2 Query: 23 KRCTRHGCTKQPSFGIAGSKAE*-CRDHAKGGMVNVFNNKCTFPGCTTIASYGEESSGTRKFCARHAEEGMVHL 241 KRC C K+PS +G K C H K M NV ++KCT+P C +A+YG + +C H E V + Sbjct: 40 KRCLE--CNKRPSHNYSGEKVPIYCATHKKSDMENVVSDKCTYPSCKILATYGLPGTKKALYCKLHKPENTVDV 111 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig134.2617.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig134.2617.1 >prot_L-elsbetiae_contig134.2617.1 ID=prot_L-elsbetiae_contig134.2617.1|Name=mRNA_L-elsbetiae_contig134.2617.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=72bp MVNVFNNKCTFPGCTTIASYGEESSGTRKFCARHAEEGMVHLSGRSRGDSback to top mRNA from alignment at L-elsbetiae_contig134:15293..15623+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig134.2617.1 ID=mRNA_L-elsbetiae_contig134.2617.1|Name=mRNA_L-elsbetiae_contig134.2617.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=331bp|location=Sequence derived from alignment at L-elsbetiae_contig134:15293..15623+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig134:15293..15623+ >mRNA_L-elsbetiae_contig134.2617.1 ID=mRNA_L-elsbetiae_contig134.2617.1|Name=mRNA_L-elsbetiae_contig134.2617.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=432bp|location=Sequence derived from alignment at L-elsbetiae_contig134:15293..15623+ (Laminarionema elsbetiae ELsaHSoW15)back to top |