mRNA_L-elsbetiae_contig13268.2537.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig13268.2537.1 vs. uniprot
Match: D8LSC5_ECTSI (EsV-1-199 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LSC5_ECTSI) HSP 1 Score: 63.9 bits (154), Expect = 2.080e-10 Identity = 33/56 (58.93%), Postives = 39/56 (69.64%), Query Frame = 2 Query: 71 SSNLRVIRLFIDAGADTTSTVRVKNFAGVILY-DTPLTFAVRLLREKTINGKDFTE 235 S N R++RL +DAGADTTSTVRV N G + Y DTPL LLREK ++GK TE Sbjct: 75 SGNPRIVRLLVDAGADTTSTVRVTNLNGGVEYNDTPLAVTTSLLREKVVDGKPATE 130
BLAST of mRNA_L-elsbetiae_contig13268.2537.1 vs. uniprot
Match: A0A6H5KSA9_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KSA9_9PHAE) HSP 1 Score: 54.3 bits (129), Expect = 1.130e-6 Identity = 30/58 (51.72%), Postives = 39/58 (67.24%), Query Frame = 2 Query: 65 LGSSNLRVIRLFIDAGADTTSTVRVKNFAGVILY-DTPLTFAVRLLREKTINGKDFTE 235 L S + RV+RLF+DAGADT STVR+ N GV L+ TPL + LLR++ G D T+ Sbjct: 460 LRSGSPRVLRLFLDAGADTASTVRITNKEGVQLFRGTPLAYTTWLLRDQQARGIDSTK 517
BLAST of mRNA_L-elsbetiae_contig13268.2537.1 vs. uniprot
Match: D7FYA6_ECTSI (Similar to ankyrin 2,3/unc44 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FYA6_ECTSI) HSP 1 Score: 50.4 bits (119), Expect = 2.560e-5 Identity = 29/64 (45.31%), Postives = 40/64 (62.50%), Query Frame = 2 Query: 47 LARTFVLGSSNLRVIRLFIDAGADTTSTVRVKNFAGVILYD-TPLTFAVRLLREKTINGKDFTE 235 + R + GS RV+RLF+DAGADT STVR+ N GV ++ TPL + LLR++ D T+ Sbjct: 428 IGRALLSGSP--RVLRLFLDAGADTASTVRIANKEGVEVFSGTPLAYTTWLLRDQQAQAIDSTK 489
BLAST of mRNA_L-elsbetiae_contig13268.2537.1 vs. uniprot
Match: D7FT11_ECTSI (EsV-1-1 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FT11_ECTSI) HSP 1 Score: 48.9 bits (115), Expect = 8.910e-5 Identity = 26/53 (49.06%), Postives = 36/53 (67.92%), Query Frame = 2 Query: 83 RVIRLFIDAGADTTSTVRVKNF-AGVILYDTPLTFAVRLLREKTI-NGKDFTE 235 R++R+ +DAGADTTS V+V N GV+ DTPL F LR+K + +GK T+ Sbjct: 399 RIVRMLVDAGADTTSPVQVMNLKGGVVFNDTPLAFTKLRLRKKIVADGKPATK 451 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig13268.2537.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig13268.2537.1 >prot_L-elsbetiae_contig13268.2537.1 ID=prot_L-elsbetiae_contig13268.2537.1|Name=mRNA_L-elsbetiae_contig13268.2537.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=56bp TSRSLTRSFTSFSVHPRTYLRTRFKQSKSYPAVHRRRSGHDIDRSSEELRback to top mRNA from alignment at L-elsbetiae_contig13268:3002..3432- Legend: polypeptideCDSUTR Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig13268.2537.1 ID=mRNA_L-elsbetiae_contig13268.2537.1|Name=mRNA_L-elsbetiae_contig13268.2537.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=431bp|location=Sequence derived from alignment at L-elsbetiae_contig13268:3002..3432- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig13268:3002..3432- >mRNA_L-elsbetiae_contig13268.2537.1 ID=mRNA_L-elsbetiae_contig13268.2537.1|Name=mRNA_L-elsbetiae_contig13268.2537.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=336bp|location=Sequence derived from alignment at L-elsbetiae_contig13268:3002..3432- (Laminarionema elsbetiae ELsaHSoW15)back to top |