mRNA_L-elsbetiae_contig13124.2456.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig13124.2456.1 vs. uniprot
Match: A0A6H5KKQ5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KKQ5_9PHAE) HSP 1 Score: 68.9 bits (167), Expect = 2.680e-12 Identity = 37/63 (58.73%), Postives = 43/63 (68.25%), Query Frame = 1 Query: 1 QWMAGSDLLVKPVVSEGATVASVYLPAPPPPGETEEGSS----SGTASLWYDVDTLEAVKGAG 177 QWMAG+DLLVKPVV+EGATVA VY P EG S + TASLWYDV+TL+ V+ G Sbjct: 114 QWMAGADLLVKPVVTEGATVADVYFPG------VAEGCSGTTTTSTASLWYDVETLQVVEVTG 170
BLAST of mRNA_L-elsbetiae_contig13124.2456.1 vs. uniprot
Match: A0A7S2PVF9_9STRA (Hypothetical protein n=1 Tax=Skeletonema marinoi TaxID=267567 RepID=A0A7S2PVF9_9STRA) HSP 1 Score: 48.1 bits (113), Expect = 7.320e-5 Identity = 26/59 (44.07%), Postives = 32/59 (54.24%), Query Frame = 1 Query: 1 QWMAGSDLLVKPVVSEGATVASVYLPAPPPPGETEEGSSSGTASLWYDVDTLEAVKGAG 177 Q++ GSDLLVKPV S GAT + V P A WYDVDT++ V+ AG Sbjct: 922 QYLIGSDLLVKPVTSAGATTSHVLFPL---------------ADCWYDVDTMQRVELAG 965 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig13124.2456.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig13124.2456.1 >prot_L-elsbetiae_contig13124.2456.1 ID=prot_L-elsbetiae_contig13124.2456.1|Name=mRNA_L-elsbetiae_contig13124.2456.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=57bp MAGSDLLVKPVVSEGATVASVYLPAPPPPGETEEGSSSGTASLWYDVDTLback to top mRNA from alignment at L-elsbetiae_contig13124:1350..1876- Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig13124.2456.1 ID=mRNA_L-elsbetiae_contig13124.2456.1|Name=mRNA_L-elsbetiae_contig13124.2456.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=527bp|location=Sequence derived from alignment at L-elsbetiae_contig13124:1350..1876- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig13124:1350..1876- >mRNA_L-elsbetiae_contig13124.2456.1 ID=mRNA_L-elsbetiae_contig13124.2456.1|Name=mRNA_L-elsbetiae_contig13124.2456.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=342bp|location=Sequence derived from alignment at L-elsbetiae_contig13124:1350..1876- (Laminarionema elsbetiae ELsaHSoW15)back to top |