mRNA_L-elsbetiae_contig13025.2399.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig13025.2399.1 vs. uniprot
Match: B8ME45_TALSN (Ankyrin, putative n=1 Tax=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) TaxID=441959 RepID=B8ME45_TALSN) HSP 1 Score: 54.3 bits (129), Expect = 4.080e-7 Identity = 27/55 (49.09%), Postives = 35/55 (63.64%), Query Frame = 1 Query: 1 LQLIEHGAWVDATTRSKATPLHLAVQAGQLDAIRLLVSRRADLEAQDWFGKTALH 165 LQLIE GA + + + T LHLA +AG LDA+R+L+SR + QD G T LH Sbjct: 972 LQLIEKGADISKSNNKRQTCLHLACEAGNLDAVRILLSRGCSITLQDIHGSTPLH 1026
BLAST of mRNA_L-elsbetiae_contig13025.2399.1 vs. uniprot
Match: A0A1D2ML26_ORCCI (Ankyrin-3 n=1 Tax=Orchesella cincta TaxID=48709 RepID=A0A1D2ML26_ORCCI) HSP 1 Score: 53.1 bits (126), Expect = 1.040e-6 Identity = 25/43 (58.14%), Postives = 31/43 (72.09%), Query Frame = 1 Query: 13 EHGAWVDATTRSKATPLHLAVQAGQLDAIRLLVSRRADLEAQD 141 EHGA+VDA T K TPLHLA + GQL+ RLL+ RA+ +A D Sbjct: 148 EHGAYVDALTLKKQTPLHLAAETGQLEVCRLLIGLRANPDAAD 190
BLAST of mRNA_L-elsbetiae_contig13025.2399.1 vs. uniprot
Match: A0A8K0DBX2_9COLE (Uncharacterized protein n=1 Tax=Ignelater luminosus TaxID=2038154 RepID=A0A8K0DBX2_9COLE) HSP 1 Score: 50.4 bits (119), Expect = 9.360e-6 Identity = 24/47 (51.06%), Postives = 34/47 (72.34%), Query Frame = 1 Query: 25 WVDATTRSKATPLHLAVQAGQLDAIRLLVSRRADLEAQDWFGKTALH 165 +++ T + TPL LA Q G LDA+RLL+S+ A++EA+D G TALH Sbjct: 970 FLELQTAKQETPLILAAQGGSLDAVRLLLSKNANIEAKDCNGMTALH 1016
BLAST of mRNA_L-elsbetiae_contig13025.2399.1 vs. uniprot
Match: A0A5J4Y3D8_9CHLO (Uncharacterized protein n=1 Tax=Trebouxia sp. A1-2 TaxID=2608996 RepID=A0A5J4Y3D8_9CHLO) HSP 1 Score: 49.7 bits (117), Expect = 1.740e-5 Identity = 22/55 (40.00%), Postives = 37/55 (67.27%), Query Frame = 1 Query: 1 LQLIEHGAWVDATTRSKATPLHLAVQAGQLDAIRLLVSRRADLEAQDWFGKTALH 165 ++L+++GA + + + TPLHLA G++DA+ +L+++RAD QD G T LH Sbjct: 58 VELLKYGADIASRDNNDRTPLHLAAYVGRIDAVTMLLTKRADANVQDAKGWTPLH 112
BLAST of mRNA_L-elsbetiae_contig13025.2399.1 vs. uniprot
Match: A0A8H4C7K3_COLGL (Uncharacterized protein n=1 Tax=Colletotrichum gloeosporioides TaxID=474922 RepID=A0A8H4C7K3_COLGL) HSP 1 Score: 49.3 bits (116), Expect = 2.380e-5 Identity = 26/51 (50.98%), Postives = 33/51 (64.71%), Query Frame = 1 Query: 13 EHGAWVDATTRSKATPLHLAVQAGQLDAIRLLVSRRADLEAQDWFGKTALH 165 E+ +D TT T LH+A GQ D+I LLVSR A+++AQD G TALH Sbjct: 98 EYAIDLDITTSDGTTALHIATLLGQHDSITLLVSRGANIDAQDHHGFTALH 148 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig13025.2399.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 5
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig13025.2399.1 >prot_L-elsbetiae_contig13025.2399.1 ID=prot_L-elsbetiae_contig13025.2399.1|Name=mRNA_L-elsbetiae_contig13025.2399.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=55bp LQLIEHGAWVDATTRSKATPLHLAVQAGQLDAIRLLVSRRADLEAQDWFGback to top mRNA from alignment at L-elsbetiae_contig13025:4103..4267+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig13025.2399.1 ID=mRNA_L-elsbetiae_contig13025.2399.1|Name=mRNA_L-elsbetiae_contig13025.2399.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=165bp|location=Sequence derived from alignment at L-elsbetiae_contig13025:4103..4267+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig13025:4103..4267+ >mRNA_L-elsbetiae_contig13025.2399.1 ID=mRNA_L-elsbetiae_contig13025.2399.1|Name=mRNA_L-elsbetiae_contig13025.2399.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=330bp|location=Sequence derived from alignment at L-elsbetiae_contig13025:4103..4267+ (Laminarionema elsbetiae ELsaHSoW15)back to top |