mRNA_L-elsbetiae_contig12670.2149.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig12670.2149.1 vs. uniprot
Match: D7FUI8_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FUI8_ECTSI) HSP 1 Score: 79.0 bits (193), Expect = 2.490e-15 Identity = 38/56 (67.86%), Postives = 43/56 (76.79%), Query Frame = 1 Query: 1 DPVMTFSGSSDVFFTDGVFETVPGGTCVIQIDDPSTVTIDANEDELTLADTCYVKV 168 DPVMT + S+ V FT+G + VP GTC IQ DDPSTVTIDA+EDEL L TCYVKV Sbjct: 440 DPVMTITDSTTVSFTNGGYSNVPSGTCTIQADDPSTVTIDADEDELVLEGTCYVKV 495
BLAST of mRNA_L-elsbetiae_contig12670.2149.1 vs. uniprot
Match: A0A6H5KFA6_9PHAE (F5/8 type C domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=A0A6H5KFA6_9PHAE) HSP 1 Score: 79.0 bits (193), Expect = 2.640e-15 Identity = 38/56 (67.86%), Postives = 43/56 (76.79%), Query Frame = 1 Query: 1 DPVMTFSGSSDVFFTDGVFETVPGGTCVIQIDDPSTVTIDANEDELTLADTCYVKV 168 DPVMT + S+ V FT+G + VP GTC IQ DDPSTVTIDA+EDEL L TCYVKV Sbjct: 1107 DPVMTITDSTTVSFTNGGYSNVPSGTCTIQTDDPSTVTIDADEDELVLEGTCYVKV 1162
BLAST of mRNA_L-elsbetiae_contig12670.2149.1 vs. uniprot
Match: D7FZZ4_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FZZ4_ECTSI) HSP 1 Score: 70.5 bits (171), Expect = 2.500e-12 Identity = 36/56 (64.29%), Postives = 41/56 (73.21%), Query Frame = 1 Query: 1 DPVMTFSGSSDVFFTDGVFETVPGGTCVIQIDDPSTVTIDANEDELTLADTCYVKV 168 DPVMT S S+ V FT+ +V GTC+IQ DDPSTVTID +EDEL L TCYVKV Sbjct: 904 DPVMTISDSTAVSFTNDGSYSVASGTCIIQTDDPSTVTIDPDEDELILEGTCYVKV 959
BLAST of mRNA_L-elsbetiae_contig12670.2149.1 vs. uniprot
Match: A0A6H5KL74_9PHAE (F5/8 type C domain-containing protein n=3 Tax=Ectocarpus TaxID=2879 RepID=A0A6H5KL74_9PHAE) HSP 1 Score: 64.7 bits (156), Expect = 2.710e-10 Identity = 34/56 (60.71%), Postives = 38/56 (67.86%), Query Frame = 1 Query: 1 DPVMTFSGSSDVFFTDGVFETVPGGTCVIQIDDPSTVTIDANEDELTLADTCYVKV 168 DP+M S SS V F + V CVIQ DDPSTVTIDA+EDELTL +CYVKV Sbjct: 1099 DPIMMVSDSSTVSFNNLGLSLVEADACVIQADDPSTVTIDADEDELTLDGSCYVKV 1154 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig12670.2149.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig12670.2149.1 >prot_L-elsbetiae_contig12670.2149.1 ID=prot_L-elsbetiae_contig12670.2149.1|Name=mRNA_L-elsbetiae_contig12670.2149.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=57bp MTFSGSSDVFFTDGVFETVPGGTCVIQIDDPSTVTIDANEDELTLADTCYback to top mRNA from alignment at L-elsbetiae_contig12670:462..1044- Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig12670.2149.1 ID=mRNA_L-elsbetiae_contig12670.2149.1|Name=mRNA_L-elsbetiae_contig12670.2149.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=583bp|location=Sequence derived from alignment at L-elsbetiae_contig12670:462..1044- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig12670:462..1044- >mRNA_L-elsbetiae_contig12670.2149.1 ID=mRNA_L-elsbetiae_contig12670.2149.1|Name=mRNA_L-elsbetiae_contig12670.2149.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=342bp|location=Sequence derived from alignment at L-elsbetiae_contig12670:462..1044- (Laminarionema elsbetiae ELsaHSoW15)back to top |