mRNA_L-elsbetiae_contig11873.1602.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig11873.1602.1 vs. uniprot
Match: A0A6H5K832_9PHAE (MULE domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K832_9PHAE) HSP 1 Score: 65.9 bits (159), Expect = 3.740e-11 Identity = 37/58 (63.79%), Postives = 44/58 (75.86%), Query Frame = 1 Query: 1 MAERAVLRAGTSEKLTTFAAKAFETQRSKSSDLRASGTGNGHYTVGKQGSNYGNRVRL 174 MAERA L S++ T FAAK FE QR+KSS+L +S TGNG++TV K GSNYGNRV L Sbjct: 298 MAERAELVNSASQRFTPFAAKEFEAQRAKSSNLHSSATGNGNFTVRKLGSNYGNRVGL 355
BLAST of mRNA_L-elsbetiae_contig11873.1602.1 vs. uniprot
Match: A0A6H5KJU4_9PHAE (MULE domain-containing protein n=6 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KJU4_9PHAE) HSP 1 Score: 65.9 bits (159), Expect = 3.940e-11 Identity = 37/58 (63.79%), Postives = 44/58 (75.86%), Query Frame = 1 Query: 1 MAERAVLRAGTSEKLTTFAAKAFETQRSKSSDLRASGTGNGHYTVGKQGSNYGNRVRL 174 MAERA L S++ T FAAK FE QR+KSS+L +S TGNG++TV K GSNYGNRV L Sbjct: 190 MAERAELVNSASQRFTPFAAKEFEAQRAKSSNLHSSATGNGNFTVRKLGSNYGNRVGL 247 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig11873.1602.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig11873.1602.1 >prot_L-elsbetiae_contig11873.1602.1 ID=prot_L-elsbetiae_contig11873.1602.1|Name=mRNA_L-elsbetiae_contig11873.1602.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=59bp MAERAVLRAGTSEKLTTFAAKAFETQRSKSSDLRASGTGNGHYTVGKQGSback to top mRNA from alignment at L-elsbetiae_contig11873:5029..5618- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig11873.1602.1 ID=mRNA_L-elsbetiae_contig11873.1602.1|Name=mRNA_L-elsbetiae_contig11873.1602.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=590bp|location=Sequence derived from alignment at L-elsbetiae_contig11873:5029..5618- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig11873:5029..5618- >mRNA_L-elsbetiae_contig11873.1602.1 ID=mRNA_L-elsbetiae_contig11873.1602.1|Name=mRNA_L-elsbetiae_contig11873.1602.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=354bp|location=Sequence derived from alignment at L-elsbetiae_contig11873:5029..5618- (Laminarionema elsbetiae ELsaHSoW15)back to top |