mRNA_L-elsbetiae_contig1181.1563.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig1181.1563.1 vs. uniprot
Match: D7G0R7_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G0R7_ECTSI) HSP 1 Score: 87.0 bits (214), Expect = 2.160e-17 Identity = 51/80 (63.75%), Postives = 60/80 (75.00%), Query Frame = 2 Query: 5 HDREKVVTVVVSSVDADQVEIVEVSRAVVVDENGFEIQLPTTVPPAVLGLEVMEGFSDHGSCYDGGDDASGPIHSPVALA 244 +DREKVVTV+V+ V+ADQVEIVEVSRAV +DE G EI TT AV+GLE+ME FSDH S G A+ PIHSP A+A Sbjct: 386 YDREKVVTVIVTGVEADQVEIVEVSRAVALDEAGVEIPAMTT---AVVGLEIMEDFSDHESMD--GRVATSPIHSPAAMA 460
BLAST of mRNA_L-elsbetiae_contig1181.1563.1 vs. uniprot
Match: A0A6H5JA45_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JA45_9PHAE) HSP 1 Score: 79.7 bits (195), Expect = 1.010e-14 Identity = 48/80 (60.00%), Postives = 55/80 (68.75%), Query Frame = 2 Query: 5 HDREKVVTVVVSSVDADQVEIVEVSRAVVVDENGFEIQLPTTVPPAVLGLEVMEGFSDHGSCYDGGDDASGPIHSPVALA 244 +DREKVVTV+V+ V+ADQVEIV+VSRAV VDE G I TT V+GLE ME SDH S G A PIHSP A+A Sbjct: 1338 YDREKVVTVIVTGVEADQVEIVQVSRAVAVDEAGVAIPAMTT---GVVGLETMEDLSDHESLD--GRGAMSPIHSPAAMA 1412 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig1181.1563.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig1181.1563.1 >prot_L-elsbetiae_contig1181.1563.1 ID=prot_L-elsbetiae_contig1181.1563.1|Name=mRNA_L-elsbetiae_contig1181.1563.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=71bp GPRQGEGGDGGGVERGRRSSGDRGGFSRRGCRREWIRDSASDNRTTSGVGback to top mRNA from alignment at L-elsbetiae_contig1181:7803..8777- Legend: polypeptideCDSUTR Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig1181.1563.1 ID=mRNA_L-elsbetiae_contig1181.1563.1|Name=mRNA_L-elsbetiae_contig1181.1563.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=975bp|location=Sequence derived from alignment at L-elsbetiae_contig1181:7803..8777- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig1181:7803..8777- >mRNA_L-elsbetiae_contig1181.1563.1 ID=mRNA_L-elsbetiae_contig1181.1563.1|Name=mRNA_L-elsbetiae_contig1181.1563.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=426bp|location=Sequence derived from alignment at L-elsbetiae_contig1181:7803..8777- (Laminarionema elsbetiae ELsaHSoW15)back to top |