mRNA_L-elsbetiae_contig1144.1260.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig1144.1260.1 vs. uniprot
Match: A0A6H5JCV6_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JCV6_9PHAE) HSP 1 Score: 52.0 bits (123), Expect = 6.820e-5 Identity = 23/39 (58.97%), Postives = 32/39 (82.05%), Query Frame = 1 Query: 1 MIARDNGDSTYRVEFDDGDVEDRAPRCDIRIVAQATEET 117 +I+ DNGD+TY+V+FDDGDV D APR DIR+++ EE+ Sbjct: 80 VISTDNGDATYKVDFDDGDVLDAAPRHDIRVLSWPHEES 118
BLAST of mRNA_L-elsbetiae_contig1144.1260.1 vs. uniprot
Match: D7FKD5_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FKD5_ECTSI) HSP 1 Score: 52.0 bits (123), Expect = 6.920e-5 Identity = 23/39 (58.97%), Postives = 33/39 (84.62%), Query Frame = 1 Query: 1 MIARDNGDSTYRVEFDDGDVEDRAPRCDIRIVAQATEET 117 +I+ DNGD+TY+V+FDDGDV D APR DIR+++ + EE+ Sbjct: 80 VISIDNGDATYKVDFDDGDVLDAAPRHDIRVLSWSHEES 118 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig1144.1260.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig1144.1260.1 >prot_L-elsbetiae_contig1144.1260.1 ID=prot_L-elsbetiae_contig1144.1260.1|Name=mRNA_L-elsbetiae_contig1144.1260.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=148bp MIARDNGDSTYRVEFDDGDVEDRAPRCDIRIVAQATEETGTDDPKLPQNEback to top mRNA from alignment at L-elsbetiae_contig1144:12812..13449- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig1144.1260.1 ID=mRNA_L-elsbetiae_contig1144.1260.1|Name=mRNA_L-elsbetiae_contig1144.1260.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=638bp|location=Sequence derived from alignment at L-elsbetiae_contig1144:12812..13449- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig1144:12812..13449- >mRNA_L-elsbetiae_contig1144.1260.1 ID=mRNA_L-elsbetiae_contig1144.1260.1|Name=mRNA_L-elsbetiae_contig1144.1260.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=888bp|location=Sequence derived from alignment at L-elsbetiae_contig1144:12812..13449- (Laminarionema elsbetiae ELsaHSoW15)back to top |