mRNA_L-elsbetiae_contig10465.457.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig10465.457.1 vs. uniprot
Match: D7G2P5_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G2P5_ECTSI) HSP 1 Score: 113 bits (283), Expect = 1.460e-27 Identity = 55/65 (84.62%), Postives = 59/65 (90.77%), Query Frame = 1 Query: 19 QQLHRYLVHRESVSYRREGFRNMGNTCYLNACLQGLLSLSGFVGDLQRKCWVLAMLKPPPPPSAG 213 QQL RY+ HRE +S RREGFRNMGNTCYLNACLQGLLSLSGFVGDL+RKCWVLAMLKPPPP + G Sbjct: 241 QQLTRYMTHREPLS-RREGFRNMGNTCYLNACLQGLLSLSGFVGDLRRKCWVLAMLKPPPPAATG 304
BLAST of mRNA_L-elsbetiae_contig10465.457.1 vs. uniprot
Match: A0A6H5KUE2_9PHAE (USP domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KUE2_9PHAE) HSP 1 Score: 112 bits (280), Expect = 3.700e-27 Identity = 55/67 (82.09%), Postives = 59/67 (88.06%), Query Frame = 1 Query: 13 GVQQLHRYLVHRESVSYRREGFRNMGNTCYLNACLQGLLSLSGFVGDLQRKCWVLAMLKPPPPPSAG 213 G QQL RY+ HRE +S RREGFRNMGNTCYLNACLQGLLSLS FVGDL+RKCWVLAMLKPPPP + G Sbjct: 344 GGQQLTRYMTHREPLS-RREGFRNMGNTCYLNACLQGLLSLSDFVGDLRRKCWVLAMLKPPPPAATG 409
BLAST of mRNA_L-elsbetiae_contig10465.457.1 vs. uniprot
Match: A0A835YKZ9_9STRA (USP domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YKZ9_9STRA) HSP 1 Score: 57.8 bits (138), Expect = 6.160e-8 Identity = 27/41 (65.85%), Postives = 29/41 (70.73%), Query Frame = 1 Query: 64 RREGFRNMGNTCYLNACLQGLLSLSGFVGDLQRKCWVLAML 186 R EGFRN+GNTCYLNA LQ LL L FV DLQ W A+L Sbjct: 329 RSEGFRNLGNTCYLNATLQALLGLKEFVDDLQASVWARAIL 369
BLAST of mRNA_L-elsbetiae_contig10465.457.1 vs. uniprot
Match: L8HG84_ACACA (Ubiquitin carboxyl-terminal hydrolase n=1 Tax=Acanthamoeba castellanii str. Neff TaxID=1257118 RepID=L8HG84_ACACA) HSP 1 Score: 52.0 bits (123), Expect = 6.510e-6 Identity = 22/42 (52.38%), Postives = 32/42 (76.19%), Query Frame = 1 Query: 58 SYRREGFRNMGNTCYLNACLQGLLSLSGFVGDLQRKCWVLAM 183 +++REG +N+GNTCY+NA LQ LLSL FV D+ R ++ A+ Sbjct: 87 AFKREGLQNLGNTCYMNAVLQSLLSLETFVSDMNRDEFIQAL 128
BLAST of mRNA_L-elsbetiae_contig10465.457.1 vs. uniprot
Match: L8HIP5_ACACA (Ubiquitin interaction motif domain containing protein n=1 Tax=Acanthamoeba castellanii str. Neff TaxID=1257118 RepID=L8HIP5_ACACA) HSP 1 Score: 52.0 bits (123), Expect = 6.630e-6 Identity = 22/42 (52.38%), Postives = 32/42 (76.19%), Query Frame = 1 Query: 58 SYRREGFRNMGNTCYLNACLQGLLSLSGFVGDLQRKCWVLAM 183 +++REG +N+GNTCY+NA LQ LLSL FV D+ R ++ A+ Sbjct: 87 AFKREGLQNLGNTCYMNAVLQSLLSLETFVSDMNRDEFIQAL 128
BLAST of mRNA_L-elsbetiae_contig10465.457.1 vs. uniprot
Match: A0A067C580_SAPPC (Uncharacterized protein n=1 Tax=Saprolegnia parasitica (strain CBS 223.65) TaxID=695850 RepID=A0A067C580_SAPPC) HSP 1 Score: 52.0 bits (123), Expect = 6.730e-6 Identity = 25/49 (51.02%), Postives = 32/49 (65.31%), Query Frame = 1 Query: 55 VSYRREGFRNMGNTCYLNACLQGLLSLSGFVGDLQRKCWVLAMLKPPPP 201 V+ ++G N+GNTCY+NA LQ LLSL FV L+ WV A+ K P P Sbjct: 1022 VAKSQQGLVNLGNTCYMNAVLQALLSLQAFVTTLRDDAWVTALTKMPLP 1070
BLAST of mRNA_L-elsbetiae_contig10465.457.1 vs. uniprot
Match: T0R7M6_SAPDV (Ubiquitin carboxyl-terminal hydrolase n=1 Tax=Saprolegnia diclina (strain VS20) TaxID=1156394 RepID=T0R7M6_SAPDV) HSP 1 Score: 51.6 bits (122), Expect = 9.060e-6 Identity = 24/49 (48.98%), Postives = 32/49 (65.31%), Query Frame = 1 Query: 55 VSYRREGFRNMGNTCYLNACLQGLLSLSGFVGDLQRKCWVLAMLKPPPP 201 V+ ++G N+GNTCY+NA LQ LLSL FV L+ WV ++ K P P Sbjct: 389 VAKSQQGLVNLGNTCYMNAVLQALLSLQAFVSTLRDDAWVTSLTKVPLP 437
BLAST of mRNA_L-elsbetiae_contig10465.457.1 vs. uniprot
Match: A0A1V9Y9L8_9STRA (Ubiquitin-specific protease n=1 Tax=Achlya hypogyna TaxID=1202772 RepID=A0A1V9Y9L8_9STRA) HSP 1 Score: 50.4 bits (119), Expect = 2.320e-5 Identity = 24/44 (54.55%), Postives = 29/44 (65.91%), Query Frame = 1 Query: 70 EGFRNMGNTCYLNACLQGLLSLSGFVGDLQRKCWVLAMLKPPPP 201 +G N+GNTCY+NA LQ LLSL GFV L+ WV + K P P Sbjct: 398 QGLVNLGNTCYMNAVLQALLSLQGFVQVLRDDAWVAIVTKHPLP 441 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig10465.457.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 8
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig10465.457.1 >prot_L-elsbetiae_contig10465.457.1 ID=prot_L-elsbetiae_contig10465.457.1|Name=mRNA_L-elsbetiae_contig10465.457.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=77bp MQQRGVQQLHRYLVHRESVSYRREGFRNMGNTCYLNACLQGLLSLSGFVGback to top mRNA from alignment at L-elsbetiae_contig10465:362..1175- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig10465.457.1 ID=mRNA_L-elsbetiae_contig10465.457.1|Name=mRNA_L-elsbetiae_contig10465.457.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=814bp|location=Sequence derived from alignment at L-elsbetiae_contig10465:362..1175- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig10465:362..1175- >mRNA_L-elsbetiae_contig10465.457.1 ID=mRNA_L-elsbetiae_contig10465.457.1|Name=mRNA_L-elsbetiae_contig10465.457.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=462bp|location=Sequence derived from alignment at L-elsbetiae_contig10465:362..1175- (Laminarionema elsbetiae ELsaHSoW15)back to top |