prot_H-elongata_contig79013.15564.1 (polypeptide) Himanthalia elongata Himel1 dioecious

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview


Name	mRNA_H-elongata_contig79013.15564.1
Unique Name	prot_H-elongata_contig79013.15564.1
Type	polypeptide
Organism	Himanthalia elongata Himel1 dioecious (Himanthalia elongata Himel1 dioecious)
Sequence length	123

Homology

[Close]

BLAST of mRNA_H-elongata_contig79013.15564.1 vs. uniprot
Match: D7G8H7_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7G8H7_ECTSI)

HSP 1 Score: 109 bits (273), Expect = 4.650e-28
Identity = 65/123 (52.85%), Postives = 83/123 (67.48%), Query Frame = 0

Query:    1 MFGFASAAIFTPARGEESTIGIPAAPGVVLGSSLGVLAAQFAGEESQTARQVLYKVVASIGAATATTVACAGLLGESELQEGGITGIVTLATVASLGSSAGLVCSRYHKGVLRGRISPVDDDR 123
            MFGF SAA+ TP  G E   G+PAAPGV++GSSLGVLAA  AGE +Q  RQ+LY ++ S+GAA  TT AC+ L G+  LQ GG  GI+ LATVASLGS+A     +++  + R   +   DDR
Sbjct:   23 MFGFVSAALLTPIDGGEREHGLPAAPGVIMGSSLGVLAAYSAGEGTQPLRQLLYLLLLSVGAAAVTTAACSWLTGDV-LQNGGSVGIMVLATVASLGSTAVFTIDKHNMLLTRAATAAAFDDR 144

The following BLAST results are available for this feature:

BLAST of mRNA_H-elongata_contig79013.15564.1 vs. uniprot

BLAST of mRNA_H-elongata_contig79013.15564.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 1


Match Name	E-value	Identity	Description
D7G8H7_ECTSI	4.650e-28	52.85	Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2...	[more]

InterPro

Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29


IPR Term	IPR Description	Source	Source Term	Source Description	Alignment
None	No IPR available	PHOBIUS	SIGNAL_PEPTIDE_N_REGION	Signal peptide N-region	coord: 1..1
None	No IPR available	PHOBIUS	CYTOPLASMIC_DOMAIN	Cytoplasmic domain	coord: 106..123
None	No IPR available	PHOBIUS	SIGNAL_PEPTIDE_C_REGION	Signal peptide C-region	coord: 11..15
None	No IPR available	PHOBIUS	SIGNAL_PEPTIDE	Signal Peptide	coord: 1..15
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 52..74
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 25..43
None	No IPR available	PHOBIUS	SIGNAL_PEPTIDE_H_REGION	Signal peptide H-region	coord: 2..10
None	No IPR available	PHOBIUS	NON_CYTOPLASMIC_DOMAIN	Non cytoplasmic domain	coord: 75..85
None	No IPR available	PHOBIUS	NON_CYTOPLASMIC_DOMAIN	Non cytoplasmic domain	coord: 16..24
None	No IPR available	PHOBIUS	CYTOPLASMIC_DOMAIN	Cytoplasmic domain	coord: 44..51
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 86..105
None	No IPR available	TMHMM	TMhelix		coord: 84..103
None	No IPR available	TMHMM	TMhelix		coord: 20..39
None	No IPR available	TMHMM	TMhelix		coord: 52..74

Alignments

The following features are aligned


Aligned Feature	Feature Type	Alignment Location
H-elongata_contig79013	contig	H-elongata_contig79013:953..2052 +

Analyses

This polypeptide is derived from or has results from the following analyses


Analysis Name	Date Performed
InterProScan on OGS1.0	2022-09-29
Diamond blastp: OGS1.0 vs UniRef90	2022-09-16
OGS1.0 of Himanthalia elongata Himel1 dioecious	2021-02-24

Relationships

This polypeptide derives from the following mRNA feature(s):


Feature Name	Unique Name	Species	Type	Position
mRNA_H-elongata_contig79013.15564.1	mRNA_H-elongata_contig79013.15564.1	Himanthalia elongata Himel1 dioecious	mRNA	H-elongata_contig79013 923..2052 +

Sequences

The following sequences are available for this feature:

polypeptide sequence

polypeptide sequence

>prot_H-elongata_contig79013.15564.1 ID=prot_H-elongata_contig79013.15564.1|Name=mRNA_H-elongata_contig79013.15564.1|organism=Himanthalia elongata Himel1 dioecious|type=polypeptide|length=123bp
MFGFASAAIFTPARGEESTIGIPAAPGVVLGSSLGVLAAQFAGEESQTAR
QVLYKVVASIGAATATTVACAGLLGESELQEGGITGIVTLATVASLGSSA
GLVCSRYHKGVLRGRISPVDDDR