|
|
Homology
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
|---|
| IPR011990 | Tetratricopeptide-like helical domain superfamily | GENE3D | 1.25.40.10 | | coord: 367..507
e-value: 3.2E-32
score: 114.3
coord: 184..329
e-value: 7.0E-31
score: 109.9
coord: 66..183
e-value: 2.7E-23
score: 85.0 |
| IPR002885 | Pentatricopeptide repeat | TIGRFAM | TIGR00756 | TIGR00756 | coord: 113..147
e-value: 7.0E-5
score: 20.7
coord: 267..300
e-value: 5.5E-9
score: 33.7
coord: 339..366
e-value: 6.8E-4
score: 17.6
coord: 303..329
e-value: 1.7E-4
score: 19.5
coord: 446..471
e-value: 3.2E-4
score: 18.7
coord: 36..63
e-value: 0.0019
score: 16.3
coord: 194..220
e-value: 7.3E-4
score: 17.5 |
| IPR002885 | Pentatricopeptide repeat | PFAM | PF13812 | PPR_3 | coord: 372..420
e-value: 9.3E-7
score: 28.8 |
| IPR002885 | Pentatricopeptide repeat | PFAM | PF13041 | PPR_2 | coord: 264..311
e-value: 2.7E-12
score: 46.7 |
| IPR002885 | Pentatricopeptide repeat | PFAM | PF01535 | PPR | coord: 150..176
e-value: 0.041
score: 14.1
coord: 446..475
e-value: 1.5E-4
score: 21.8
coord: 339..364
e-value: 0.012
score: 15.8
coord: 114..138
e-value: 0.004
score: 17.3
coord: 36..63
e-value: 1.6E-4
score: 21.7
coord: 194..220
e-value: 0.0011
score: 19.0 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 110..144
score: 8.758 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 336..366
score: 7.476 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 147..177
score: 8.868 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 191..221
score: 9.58 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 373..407
score: 6.544 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 444..478
score: 9.964 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 1..27
score: 5.492 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 300..334
score: 8.353 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 74..109
score: 6.522 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 408..442
score: 10.128 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 33..63
score: 9.843 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 265..299
score: 12.573 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 482..507
score: 6.467 |
| None | No IPR available | PANTHER | PTHR46128 | FAMILY NOT NAMED | coord: 371..505
coord: 262..385
coord: 6..62
coord: 75..221 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-elongata_contig66110.14202.1 ID=prot_H-elongata_contig66110.14202.1|Name=mRNA_H-elongata_contig66110.14202.1|organism=Himanthalia elongata Himel1 dioecious|type=polypeptide|length=507bp
HRAAITAAGNGGLLNEALQLLCDMKNDPALEVDVPSYNAAITACGRCRRL
EPALALLEEMKKSSSGGGPPLSPGVITLGACLQACASCKDWRAALDLLHE
APEALGVSPDSLCYASAISACAKAGRWEKGVALFREITVDRVGFGPDALT
YSAVIVACGYGGRWEMSLRFLRQMEEEAGEDGGGEEGVRPDVACYNSAIS
ACARSAQADQALSLLREMQAKAKLAEGGISGGGKSSSNKGNKGNSNGDDD
RKKRGNKSGVVVKPNVVSYNAAINALGAAGRWVEALGLLKEMVARGISPS
ASTYTACIVACGSAGEWKKALDLLEAMRKIDGVQLTLGSYNAAMKACGQA
DRGEEARALLRSMSMSAGASGGIEPDASTYTACIAASGDGEHAVELLREM
SARGLAPNTITYNAAITATGRGGDWAQALSLLREMPPAGIAAPDTVSYNS
AIKALAGAGEWERAVGLLREMGGSGSGRVRADDASYAMVVKACETAGRYA
EAATLLA back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
| Term | Definition |
|---|
| IPR011990 | TPR-like_helical_dom_sf |
| IPR002885 | Pentatricopeptide_repeat |
|