prot_H-elongata_contig103692.306.1 (polypeptide) Himanthalia elongata Himel1 dioecious

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_H-elongata_contig103692.306.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 25
ZOOM
x 1
POSITION
0
DVPSAEKAQYIGLDCEMVGVGPNGCRSALAWCCVVDWDGKIIFDKYVNPAERVTDFRTFVSGVRAKDLIGGLSLRQCQIEIAAIMKEKYIVGHALQNDLKVQY*102030405060708090100Expect = 3.60e-44 / Id = 74.23Expect = 5.03e-34 / Id = 58.42Expect = 6.55e-31 / Id = 58.42Expect = 8.65e-30 / Id = 52.63Expect = 1.47e-29 / Id = 55.56Expect = 1.81e-29 / Id = 50.53Expect = 2.45e-29 / Id = 51.02Expect = 2.89e-29 / Id = 54.74Expect = 5.55e-29 / Id = 50.53Expect = 5.94e-29 / Id = 54.74SequenceD8LAZ6_ECTSIW7U6T2_9STRAA0A836CG98_9STRAA0A1V9YXD8_9STRAA0A067BGR3_SAPPCA0A024UI79_9STRAA0A7S1YYA6_TRICVA0A316U9R8_9BASIA0A6G0X6W8_9STRAA0A316VDZ4_9BASI
Match NameE-valueIdentityDescription
D8LAZ6_ECTSI3.600e-4474.23RNA exonuclease 4 n=1 Tax=Ectocarpus siliculosus T... [more]
W7U6T2_9STRA5.030e-3458.42RNA exonuclease 4 n=2 Tax=Monodopsidaceae TaxID=42... [more]
A0A836CG98_9STRA6.550e-3158.42RNA exonuclease 4 n=1 Tax=Tribonema minus TaxID=30... [more]
A0A1V9YXD8_9STRA8.650e-3052.63RNA exonuclease 4 n=1 Tax=Thraustotheca clavata Ta... [more]
A0A067BGR3_SAPPC1.470e-2955.56RNA exonuclease 4 (Fragment) n=1 Tax=Saprolegnia p... [more]
A0A024UI79_9STRA1.810e-2950.53RNA exonuclease 4 n=2 Tax=Aphanomyces invadans Tax... [more]
A0A7S1YYA6_TRICV2.450e-2951.02RNA exonuclease 4 (Fragment) n=1 Tax=Trieres chine... [more]
A0A316U9R8_9BASI2.890e-2954.74RNA exonuclease 4 n=1 Tax=Pseudomicrostroma glucos... [more]
A0A6G0X6W8_9STRA5.550e-2950.53RNA exonuclease 4 n=1 Tax=Aphanomyces euteiches Ta... [more]
A0A316VDZ4_9BASI5.940e-2954.74RNA exonuclease 4 n=1 Tax=Meira miltonrushii TaxID... [more]

Pages

back to top