mRNA_H-elongata_contig103760.317.1 (mRNA) Himanthalia elongata Himel1 dioecious
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_H-elongata_contig103760.317.1 vs. uniprot
Match: K3WJU9_GLOUD (Raptor_N domain-containing protein n=1 Tax=Globisporangium ultimum (strain ATCC 200006 / CBS 805.95 / DAOM BR144) TaxID=431595 RepID=K3WJU9_GLOUD) HSP 1 Score: 60.1 bits (144), Expect = 4.070e-9 Identity = 26/54 (48.15%), Postives = 39/54 (72.22%), Query Frame = 1 Query: 1 QILSSDGEELSRITSYNGFAANRLGSMSCLAFHPNELILAAGDSASIVSLFAPD 162 ++ SDGE+L+ I + GF R+G +SCLAFHP+ L LAAG + S+V+++A D Sbjct: 1434 KVFKSDGEQLALIRYHEGFLGERIGPVSCLAFHPHRLFLAAGATDSVVAIYASD 1487
BLAST of mRNA_H-elongata_contig103760.317.1 vs. uniprot
Match: A0A5D6YCM0_9STRA (Raptor_N domain-containing protein n=1 Tax=Pythium brassicum TaxID=1485010 RepID=A0A5D6YCM0_9STRA) HSP 1 Score: 58.9 bits (141), Expect = 1.040e-8 Identity = 25/54 (46.30%), Postives = 40/54 (74.07%), Query Frame = 1 Query: 1 QILSSDGEELSRITSYNGFAANRLGSMSCLAFHPNELILAAGDSASIVSLFAPD 162 ++ SDGE+L+ I + GF R+G +SCLAFHP+ L+LA+G + S+V+++A D Sbjct: 1375 KVFKSDGEQLALIRYHEGFLGERIGPVSCLAFHPHRLLLASGATDSVVAVYAGD 1428
BLAST of mRNA_H-elongata_contig103760.317.1 vs. uniprot
Match: A0A2D4BQ72_PYTIN (Uncharacterized protein n=1 Tax=Pythium insidiosum TaxID=114742 RepID=A0A2D4BQ72_PYTIN) HSP 1 Score: 58.5 bits (140), Expect = 1.420e-8 Identity = 25/54 (46.30%), Postives = 39/54 (72.22%), Query Frame = 1 Query: 1 QILSSDGEELSRITSYNGFAANRLGSMSCLAFHPNELILAAGDSASIVSLFAPD 162 ++ SDGE+L+ I + GF R+G +SCLAFHP+ L LAAG + S+V++++ D Sbjct: 790 KVFRSDGEQLALIRHHEGFLGERIGPVSCLAFHPHRLYLAAGATDSVVAIYSSD 843
BLAST of mRNA_H-elongata_contig103760.317.1 vs. uniprot
Match: A0A2D4CI46_PYTIN (Regulatory-associated protein of mTOR n=1 Tax=Pythium insidiosum TaxID=114742 RepID=A0A2D4CI46_PYTIN) HSP 1 Score: 58.5 bits (140), Expect = 1.420e-8 Identity = 25/54 (46.30%), Postives = 39/54 (72.22%), Query Frame = 1 Query: 1 QILSSDGEELSRITSYNGFAANRLGSMSCLAFHPNELILAAGDSASIVSLFAPD 162 ++ SDGE+L+ I + GF R+G +SCLAFHP+ L LAAG + S+V++++ D Sbjct: 1246 KVFRSDGEQLALIRHHEGFLGERIGPVSCLAFHPHRLYLAAGATDSVVAIYSSD 1299
BLAST of mRNA_H-elongata_contig103760.317.1 vs. uniprot
Match: A0A6A3UUR4_9STRA (Uncharacterized protein n=1 Tax=Phytophthora fragariae TaxID=53985 RepID=A0A6A3UUR4_9STRA) HSP 1 Score: 58.2 bits (139), Expect = 1.920e-8 Identity = 25/55 (45.45%), Postives = 39/55 (70.91%), Query Frame = 1 Query: 1 QILSSDGEELSRITSYNGFAANRLGSMSCLAFHPNELILAAGDSASIVSLFAPDD 165 ++ SDGE+L+ I + GF R+G +SCLAFHP L LAAG + S+V++++ D+ Sbjct: 389 KVFRSDGEQLALIRYHEGFLGERIGPVSCLAFHPRRLFLAAGATDSVVAVYSSDN 443
BLAST of mRNA_H-elongata_contig103760.317.1 vs. uniprot
Match: A0A6A4AGY7_9STRA (Raptor_N domain-containing protein n=7 Tax=Phytophthora fragariae TaxID=53985 RepID=A0A6A4AGY7_9STRA) HSP 1 Score: 58.2 bits (139), Expect = 1.940e-8 Identity = 25/55 (45.45%), Postives = 39/55 (70.91%), Query Frame = 1 Query: 1 QILSSDGEELSRITSYNGFAANRLGSMSCLAFHPNELILAAGDSASIVSLFAPDD 165 ++ SDGE+L+ I + GF R+G +SCLAFHP L LAAG + S+V++++ D+ Sbjct: 747 KVFRSDGEQLALIRYHEGFLGERIGPVSCLAFHPRRLFLAAGATDSVVAVYSSDN 801
BLAST of mRNA_H-elongata_contig103760.317.1 vs. uniprot
Match: A0A6G0SMU2_9STRA (Regulatory-associated protein of n=1 Tax=Phytophthora fragariae TaxID=53985 RepID=A0A6G0SMU2_9STRA) HSP 1 Score: 58.2 bits (139), Expect = 1.940e-8 Identity = 25/55 (45.45%), Postives = 39/55 (70.91%), Query Frame = 1 Query: 1 QILSSDGEELSRITSYNGFAANRLGSMSCLAFHPNELILAAGDSASIVSLFAPDD 165 ++ SDGE+L+ I + GF R+G +SCLAFHP L LAAG + S+V++++ D+ Sbjct: 992 KVFRSDGEQLALIRYHEGFLGERIGPVSCLAFHPRRLFLAAGATDSVVAVYSSDN 1046
BLAST of mRNA_H-elongata_contig103760.317.1 vs. uniprot
Match: A0A8J5IKW7_9STRA (Raptor_N domain-containing protein n=1 Tax=Phytophthora aleatoria TaxID=2496075 RepID=A0A8J5IKW7_9STRA) HSP 1 Score: 58.2 bits (139), Expect = 1.940e-8 Identity = 25/54 (46.30%), Postives = 39/54 (72.22%), Query Frame = 1 Query: 1 QILSSDGEELSRITSYNGFAANRLGSMSCLAFHPNELILAAGDSASIVSLFAPD 162 ++ SDGE+L+ I + GF R+G +SCLAFHP+ L LAAG + S+V++++ D Sbjct: 1051 KVFRSDGEQLALIRYHEGFLGERIGPVSCLAFHPHRLFLAAGATDSVVAVYSSD 1104
BLAST of mRNA_H-elongata_contig103760.317.1 vs. uniprot
Match: H3G5Z2_PHYRM (Raptor_N domain-containing protein n=5 Tax=Phytophthora TaxID=4783 RepID=H3G5Z2_PHYRM) HSP 1 Score: 58.2 bits (139), Expect = 1.940e-8 Identity = 25/54 (46.30%), Postives = 39/54 (72.22%), Query Frame = 1 Query: 1 QILSSDGEELSRITSYNGFAANRLGSMSCLAFHPNELILAAGDSASIVSLFAPD 162 ++ SDGE+L+ I + GF R+G +SCLAFHP+ L LAAG + S+V++++ D Sbjct: 1173 KVFRSDGEQLALIRYHEGFLGERIGPVSCLAFHPHRLFLAAGATDSVVAVYSSD 1226
BLAST of mRNA_H-elongata_contig103760.317.1 vs. uniprot
Match: A0A3M6VLU6_9STRA (Raptor_N domain-containing protein n=1 Tax=Peronospora effusa TaxID=542832 RepID=A0A3M6VLU6_9STRA) HSP 1 Score: 58.2 bits (139), Expect = 1.950e-8 Identity = 25/54 (46.30%), Postives = 39/54 (72.22%), Query Frame = 1 Query: 1 QILSSDGEELSRITSYNGFAANRLGSMSCLAFHPNELILAAGDSASIVSLFAPD 162 ++ SDGE+L+ I + GF R+G +SCLAFHP+ L LAAG + S+V++++ D Sbjct: 1402 KVFRSDGEQLALIRYHEGFLGERIGPISCLAFHPHRLFLAAGATDSVVAVYSSD 1455 The following BLAST results are available for this feature:
BLAST of mRNA_H-elongata_contig103760.317.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25 ZOOMx 1POSITION0
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-elongata_contig103760.317.1 >prot_H-elongata_contig103760.317.1 ID=prot_H-elongata_contig103760.317.1|Name=mRNA_H-elongata_contig103760.317.1|organism=Himanthalia elongata Himel1 dioecious|type=polypeptide|length=57bp QILSSDGEELSRITSYNGFAANRLGSMSCLAFHPNELILAAGDSASIVSLback to top mRNA from alignment at H-elongata_contig103760:1712..1882- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-elongata_contig103760.317.1 ID=mRNA_H-elongata_contig103760.317.1|Name=mRNA_H-elongata_contig103760.317.1|organism=Himanthalia elongata Himel1 dioecious|type=mRNA|length=171bp|location=Sequence derived from alignment at H-elongata_contig103760:1712..1882- (Himanthalia elongata Himel1 dioecious)back to top Coding sequence (CDS) from alignment at H-elongata_contig103760:1712..1882- >mRNA_H-elongata_contig103760.317.1 ID=mRNA_H-elongata_contig103760.317.1|Name=mRNA_H-elongata_contig103760.317.1|organism=Himanthalia elongata Himel1 dioecious|type=CDS|length=342bp|location=Sequence derived from alignment at H-elongata_contig103760:1712..1882- (Himanthalia elongata Himel1 dioecious)back to top |