mRNA_H-elongata_contig10355.295.1 (mRNA) Himanthalia elongata Himel1 dioecious
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_H-elongata_contig10355.295.1 vs. uniprot
Match: D7FIS1_ECTSI (Enoyl-CoA hydratase/isomerase family protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FIS1_ECTSI) HSP 1 Score: 95.9 bits (237), Expect = 3.250e-22 Identity = 44/50 (88.00%), Postives = 48/50 (96.00%), Query Frame = 1 Query: 1 IGIFPDVGAAYFLSRLPGGLGQYLGLTGARLRGDDLLYCGLATHLVPRDR 150 IG+FPDVG A+ LSRLPGGLGQYLGLTGARLRG+DLL+CGLATHLVPRDR Sbjct: 164 IGLFPDVGTAHVLSRLPGGLGQYLGLTGARLRGNDLLHCGLATHLVPRDR 213
BLAST of mRNA_H-elongata_contig10355.295.1 vs. uniprot
Match: A0A0V1G7Y7_9BILA (3-hydroxyisobutyryl-CoA hydrolase, mitochondrial (Fragment) n=6 Tax=Eukaryota TaxID=2759 RepID=A0A0V1G7Y7_9BILA) HSP 1 Score: 76.3 bits (186), Expect = 6.210e-17 Identity = 33/47 (70.21%), Postives = 41/47 (87.23%), Query Frame = 1 Query: 1 IGIFPDVGAAYFLSRLPGGLGQYLGLTGARLRGDDLLYCGLATHLVP 141 +G+FPDVGA+Y+LSRLPG G+Y+GLTGARL G ++L CGLATH VP Sbjct: 45 LGLFPDVGASYYLSRLPGFFGEYVGLTGARLDGAEMLACGLATHFVP 91
BLAST of mRNA_H-elongata_contig10355.295.1 vs. uniprot
Match: UPI0010A5647B (3-hydroxyisobutyryl-CoA hydrolase 1-like n=2 Tax=Prosopis alba TaxID=207710 RepID=UPI0010A5647B) HSP 1 Score: 79.7 bits (195), Expect = 7.450e-17 Identity = 34/50 (68.00%), Postives = 43/50 (86.00%), Query Frame = 1 Query: 1 IGIFPDVGAAYFLSRLPGGLGQYLGLTGARLRGDDLLYCGLATHLVPRDR 150 IG+FPDVGA+YFLSRLPG G+YLGLTG RL G++++ CGLATH VP ++ Sbjct: 39 IGLFPDVGASYFLSRLPGYFGEYLGLTGRRLNGEEMVKCGLATHFVPSEK 88
BLAST of mRNA_H-elongata_contig10355.295.1 vs. uniprot
Match: A0A2K1JC01_PHYPA (ECH_2 domain-containing protein n=2 Tax=Physcomitrium patens TaxID=3218 RepID=A0A2K1JC01_PHYPA) HSP 1 Score: 81.3 bits (199), Expect = 9.180e-17 Identity = 38/50 (76.00%), Postives = 42/50 (84.00%), Query Frame = 1 Query: 1 IGIFPDVGAAYFLSRLPGGLGQYLGLTGARLRGDDLLYCGLATHLVPRDR 150 IG+ PDVGA+YFLSRLPG LG+YLGLTG+RL G DLL CGLATH VP R Sbjct: 186 IGLHPDVGASYFLSRLPGHLGEYLGLTGSRLDGADLLSCGLATHFVPSQR 235
BLAST of mRNA_H-elongata_contig10355.295.1 vs. uniprot
Match: A0A6A1VAS5_9ROSI (3-hydroxyisobutyryl-CoA hydrolase 1 n=1 Tax=Morella rubra TaxID=262757 RepID=A0A6A1VAS5_9ROSI) HSP 1 Score: 76.3 bits (186), Expect = 2.000e-16 Identity = 34/50 (68.00%), Postives = 41/50 (82.00%), Query Frame = 1 Query: 1 IGIFPDVGAAYFLSRLPGGLGQYLGLTGARLRGDDLLYCGLATHLVPRDR 150 +G+FPDVGA+YFLSRLPG G+Y+GLTG RL G ++L CGLATH VP R Sbjct: 29 LGLFPDVGASYFLSRLPGFFGEYVGLTGTRLDGAEMLACGLATHFVPSVR 78
BLAST of mRNA_H-elongata_contig10355.295.1 vs. uniprot
Match: V4KFR1_EUTSA (ECH_2 domain-containing protein n=4 Tax=Eutrema salsugineum TaxID=72664 RepID=V4KFR1_EUTSA) HSP 1 Score: 80.1 bits (196), Expect = 2.010e-16 Identity = 36/50 (72.00%), Postives = 43/50 (86.00%), Query Frame = 1 Query: 1 IGIFPDVGAAYFLSRLPGGLGQYLGLTGARLRGDDLLYCGLATHLVPRDR 150 +G+FPDVGA+YFLSRLPG LG+Y+GLTGARL G ++L CGLATH VP R Sbjct: 141 LGLFPDVGASYFLSRLPGFLGEYVGLTGARLDGAEMLACGLATHFVPSTR 190
BLAST of mRNA_H-elongata_contig10355.295.1 vs. uniprot
Match: A0A438HXA7_VITVI (3-hydroxyisobutyryl-CoA hydrolase 1 n=1 Tax=Vitis vinifera TaxID=29760 RepID=A0A438HXA7_VITVI) HSP 1 Score: 78.2 bits (191), Expect = 2.200e-16 Identity = 35/46 (76.09%), Postives = 40/46 (86.96%), Query Frame = 1 Query: 1 IGIFPDVGAAYFLSRLPGGLGQYLGLTGARLRGDDLLYCGLATHLV 138 IG FPDVGA+YFLSRLPG G+YLGLTGARL G+++L CGLATH V Sbjct: 20 IGFFPDVGASYFLSRLPGSFGEYLGLTGARLDGNEMLACGLATHFV 65
BLAST of mRNA_H-elongata_contig10355.295.1 vs. uniprot
Match: A0A178UPH4_ARATH (CHY1 n=1 Tax=Arabidopsis thaliana TaxID=3702 RepID=A0A178UPH4_ARATH) HSP 1 Score: 77.4 bits (189), Expect = 2.350e-16 Identity = 34/47 (72.34%), Postives = 41/47 (87.23%), Query Frame = 1 Query: 1 IGIFPDVGAAYFLSRLPGGLGQYLGLTGARLRGDDLLYCGLATHLVP 141 +G+FPDVGA+YFLSRLPG G+Y+GLTGARL G ++L CGLATH VP Sbjct: 145 LGLFPDVGASYFLSRLPGFFGEYVGLTGARLDGAEMLACGLATHFVP 191
BLAST of mRNA_H-elongata_contig10355.295.1 vs. uniprot
Match: A0A178VL47_ARATH (ECH_2 domain-containing protein n=1 Tax=Arabidopsis thaliana TaxID=3702 RepID=A0A178VL47_ARATH) HSP 1 Score: 79.3 bits (194), Expect = 2.540e-16 Identity = 36/50 (72.00%), Postives = 42/50 (84.00%), Query Frame = 1 Query: 1 IGIFPDVGAAYFLSRLPGGLGQYLGLTGARLRGDDLLYCGLATHLVPRDR 150 +G+FPDVGA+YFLSRLPG G+Y+GLTGARL G +LL CGLATH VP R Sbjct: 109 LGLFPDVGASYFLSRLPGFFGEYVGLTGARLDGAELLACGLATHFVPSTR 158
BLAST of mRNA_H-elongata_contig10355.295.1 vs. uniprot
Match: UPI000901E296 (3-hydroxyisobutyryl-CoA hydrolase 1-like n=4 Tax=Ipomoea TaxID=4119 RepID=UPI000901E296) HSP 1 Score: 79.7 bits (195), Expect = 2.840e-16 Identity = 35/50 (70.00%), Postives = 43/50 (86.00%), Query Frame = 1 Query: 1 IGIFPDVGAAYFLSRLPGGLGQYLGLTGARLRGDDLLYCGLATHLVPRDR 150 +G+FPDVGA+YFLSRLPG G+YLGLTG+RL G ++L CGLATH VP +R Sbjct: 147 LGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHFVPSER 196 The following BLAST results are available for this feature:
BLAST of mRNA_H-elongata_contig10355.295.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25 ZOOMx 1POSITION0
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-elongata_contig10355.295.1 >prot_H-elongata_contig10355.295.1 ID=prot_H-elongata_contig10355.295.1|Name=mRNA_H-elongata_contig10355.295.1|organism=Himanthalia elongata Himel1 dioecious|type=polypeptide|length=51bp IGIFPDVGAAYFLSRLPGGLGQYLGLTGARLRGDDLLYCGLATHLVPRDRback to top mRNA from alignment at H-elongata_contig10355:24..176+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-elongata_contig10355.295.1 ID=mRNA_H-elongata_contig10355.295.1|Name=mRNA_H-elongata_contig10355.295.1|organism=Himanthalia elongata Himel1 dioecious|type=mRNA|length=153bp|location=Sequence derived from alignment at H-elongata_contig10355:24..176+ (Himanthalia elongata Himel1 dioecious)back to top Coding sequence (CDS) from alignment at H-elongata_contig10355:24..176+ >mRNA_H-elongata_contig10355.295.1 ID=mRNA_H-elongata_contig10355.295.1|Name=mRNA_H-elongata_contig10355.295.1|organism=Himanthalia elongata Himel1 dioecious|type=CDS|length=306bp|location=Sequence derived from alignment at H-elongata_contig10355:24..176+ (Himanthalia elongata Himel1 dioecious)back to top |