mRNA_H-elongata_contig103454.287.1 (mRNA) Himanthalia elongata Himel1 dioecious
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_H-elongata_contig103454.287.1 vs. uniprot
Match: A0A6H5KWQ0_9PHAE (AMP-binding domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KWQ0_9PHAE) HSP 1 Score: 110 bits (276), Expect = 5.660e-27 Identity = 52/57 (91.23%), Postives = 55/57 (96.49%), Query Frame = 1 Query: 7 IVSYLPLSHIAAQILDIHGPMYLGCLVAFAQPDALKGSLVKTLREIHPTVFFGVPRV 177 +VSYLPLSHIAAQILD+HGPM+LGC VAFAQPDALKGSLVKTLREI PTVFFGVPRV Sbjct: 255 VVSYLPLSHIAAQILDMHGPMFLGCTVAFAQPDALKGSLVKTLREIRPTVFFGVPRV 311
BLAST of mRNA_H-elongata_contig103454.287.1 vs. uniprot
Match: F2UAC6_SALR5 (AMP dependent ligase n=1 Tax=Salpingoeca rosetta (strain ATCC 50818 / BSB-021) TaxID=946362 RepID=F2UAC6_SALR5) HSP 1 Score: 93.2 bits (230), Expect = 9.740e-21 Identity = 45/59 (76.27%), Postives = 50/59 (84.75%), Query Frame = 1 Query: 1 ESIVSYLPLSHIAAQILDIHGPMYLGCLVAFAQPDALKGSLVKTLREIHPTVFFGVPRV 177 E IVSYLPLSHIAAQILD+H PM LG V FAQP ALKG+LV+TL+E+ PTVF GVPRV Sbjct: 246 EHIVSYLPLSHIAAQILDMHAPMILGATVWFAQPTALKGTLVQTLQEVRPTVFLGVPRV 304
BLAST of mRNA_H-elongata_contig103454.287.1 vs. uniprot
Match: K3WLR6_GLOUD (AMP-binding domain-containing protein n=1 Tax=Globisporangium ultimum (strain ATCC 200006 / CBS 805.95 / DAOM BR144) TaxID=431595 RepID=K3WLR6_GLOUD) HSP 1 Score: 92.8 bits (229), Expect = 1.330e-20 Identity = 44/59 (74.58%), Postives = 51/59 (86.44%), Query Frame = 1 Query: 1 ESIVSYLPLSHIAAQILDIHGPMYLGCLVAFAQPDALKGSLVKTLREIHPTVFFGVPRV 177 E VS+LPLSH+AAQ+LDIH PM+LG V+FA PDALKG+LV+TLREI PT FFGVPRV Sbjct: 242 ERSVSFLPLSHVAAQLLDIHVPMFLGSQVSFAGPDALKGALVETLREIRPTFFFGVPRV 300
BLAST of mRNA_H-elongata_contig103454.287.1 vs. uniprot
Match: A0A1Z5J6E1_FISSO (Long-chain-fatty-acid--CoA ligase ACSBG n=2 Tax=Fistulifera solaris TaxID=1519565 RepID=A0A1Z5J6E1_FISSO) HSP 1 Score: 92.8 bits (229), Expect = 1.330e-20 Identity = 43/59 (72.88%), Postives = 50/59 (84.75%), Query Frame = 1 Query: 1 ESIVSYLPLSHIAAQILDIHGPMYLGCLVAFAQPDALKGSLVKTLREIHPTVFFGVPRV 177 + +VSYLPLSHIAAQ LD+ P++ GC V FAQPDALKG+LV TLRE+ PTVFFGVPRV Sbjct: 257 DKLVSYLPLSHIAAQALDMFQPLFSGCKVYFAQPDALKGTLVDTLREVRPTVFFGVPRV 315
BLAST of mRNA_H-elongata_contig103454.287.1 vs. uniprot
Match: A0A5D6Y4R7_9STRA (AMP-binding domain-containing protein n=1 Tax=Pythium brassicum TaxID=1485010 RepID=A0A5D6Y4R7_9STRA) HSP 1 Score: 92.4 bits (228), Expect = 1.830e-20 Identity = 44/59 (74.58%), Postives = 51/59 (86.44%), Query Frame = 1 Query: 1 ESIVSYLPLSHIAAQILDIHGPMYLGCLVAFAQPDALKGSLVKTLREIHPTVFFGVPRV 177 E VS+LPLSH+AAQ+LDIH PM+LG V+FA PDALKG+LV+TLREI PT FFGVPRV Sbjct: 967 ERSVSFLPLSHVAAQLLDIHVPMHLGSQVSFAGPDALKGALVETLREIRPTFFFGVPRV 1025
BLAST of mRNA_H-elongata_contig103454.287.1 vs. uniprot
Match: A0A1X7TUX5_AMPQE (AMP-binding domain-containing protein n=2 Tax=Amphimedon queenslandica TaxID=400682 RepID=A0A1X7TUX5_AMPQE) HSP 1 Score: 91.7 bits (226), Expect = 3.400e-20 Identity = 40/59 (67.80%), Postives = 51/59 (86.44%), Query Frame = 1 Query: 1 ESIVSYLPLSHIAAQILDIHGPMYLGCLVAFAQPDALKGSLVKTLREIHPTVFFGVPRV 177 E ++SYLPLSH+A Q+LDI+ P+ +G V FAQPDALKGSL++TLRE+HPT+F GVPRV Sbjct: 362 ERVISYLPLSHVATQLLDIYFPLAIGASVWFAQPDALKGSLLQTLREVHPTIFLGVPRV 420
BLAST of mRNA_H-elongata_contig103454.287.1 vs. uniprot
Match: A0A7S2VCD9_9STRA (Hypothetical protein n=1 Tax=Amphiprora paludosa TaxID=265537 RepID=A0A7S2VCD9_9STRA) HSP 1 Score: 90.9 bits (224), Expect = 4.520e-20 Identity = 39/59 (66.10%), Postives = 51/59 (86.44%), Query Frame = 1 Query: 1 ESIVSYLPLSHIAAQILDIHGPMYLGCLVAFAQPDALKGSLVKTLREIHPTVFFGVPRV 177 ++++SYLPLSHIAAQ+LD+H P+ GC + FAQPDALKGS+ TL+E+ PT+FFGVPRV Sbjct: 28 DAMISYLPLSHIAAQMLDLHTPLESGCQIYFAQPDALKGSIGTTLKEVRPTIFFGVPRV 86
BLAST of mRNA_H-elongata_contig103454.287.1 vs. uniprot
Match: A0A7S2Y6D0_9STRA (Hypothetical protein n=1 Tax=Amphiprora paludosa TaxID=265537 RepID=A0A7S2Y6D0_9STRA) HSP 1 Score: 90.9 bits (224), Expect = 6.330e-20 Identity = 39/59 (66.10%), Postives = 51/59 (86.44%), Query Frame = 1 Query: 1 ESIVSYLPLSHIAAQILDIHGPMYLGCLVAFAQPDALKGSLVKTLREIHPTVFFGVPRV 177 ++++SYLPLSHIAAQ+LD+H P+ GC + FAQPDALKGS+ TL+E+ PT+FFGVPRV Sbjct: 255 DAMISYLPLSHIAAQMLDLHTPLESGCQIYFAQPDALKGSIGTTLKEVRPTIFFGVPRV 313
BLAST of mRNA_H-elongata_contig103454.287.1 vs. uniprot
Match: A0A1S3HL33_LINUN (long-chain-fatty-acid--CoA ligase ACSBG2 isoform X1 n=2 Tax=Lingula unguis TaxID=7574 RepID=A0A1S3HL33_LINUN) HSP 1 Score: 90.9 bits (224), Expect = 6.350e-20 Identity = 42/59 (71.19%), Postives = 50/59 (84.75%), Query Frame = 1 Query: 1 ESIVSYLPLSHIAAQILDIHGPMYLGCLVAFAQPDALKGSLVKTLREIHPTVFFGVPRV 177 E +VSYLPLSH+AAQI+DI+GP+ G V FA+PDALKG+L TL E+HPTVFFGVPRV Sbjct: 424 EVLVSYLPLSHVAAQIVDIYGPLIAGAAVYFARPDALKGTLRITLNEVHPTVFFGVPRV 482
BLAST of mRNA_H-elongata_contig103454.287.1 vs. uniprot
Match: A0A8K1FDL6_PYTOL (Uncharacterized protein n=1 Tax=Pythium oligandrum TaxID=41045 RepID=A0A8K1FDL6_PYTOL) HSP 1 Score: 90.5 bits (223), Expect = 8.630e-20 Identity = 42/59 (71.19%), Postives = 49/59 (83.05%), Query Frame = 1 Query: 1 ESIVSYLPLSHIAAQILDIHGPMYLGCLVAFAQPDALKGSLVKTLREIHPTVFFGVPRV 177 E VS+LPLSH+AAQ+LDIH PM+LGC + FA PDALKG+LV L+EI PT FFGVPRV Sbjct: 243 EKSVSFLPLSHVAAQLLDIHVPMHLGCEIYFAGPDALKGALVDILKEIRPTFFFGVPRV 301 The following BLAST results are available for this feature:
BLAST of mRNA_H-elongata_contig103454.287.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25 ZOOMx 1POSITION0
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-elongata_contig103454.287.1 >prot_H-elongata_contig103454.287.1 ID=prot_H-elongata_contig103454.287.1|Name=mRNA_H-elongata_contig103454.287.1|organism=Himanthalia elongata Himel1 dioecious|type=polypeptide|length=59bp ESIVSYLPLSHIAAQILDIHGPMYLGCLVAFAQPDALKGSLVKTLREIHPback to top mRNA from alignment at H-elongata_contig103454:956..1759+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-elongata_contig103454.287.1 ID=mRNA_H-elongata_contig103454.287.1|Name=mRNA_H-elongata_contig103454.287.1|organism=Himanthalia elongata Himel1 dioecious|type=mRNA|length=804bp|location=Sequence derived from alignment at H-elongata_contig103454:956..1759+ (Himanthalia elongata Himel1 dioecious)back to top Coding sequence (CDS) from alignment at H-elongata_contig103454:956..1759+ >mRNA_H-elongata_contig103454.287.1 ID=mRNA_H-elongata_contig103454.287.1|Name=mRNA_H-elongata_contig103454.287.1|organism=Himanthalia elongata Himel1 dioecious|type=CDS|length=354bp|location=Sequence derived from alignment at H-elongata_contig103454:956..1759+ (Himanthalia elongata Himel1 dioecious)back to top |