mRNA_H-elongata_contig103367.279.1 (mRNA) Himanthalia elongata Himel1 dioecious
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_H-elongata_contig103367.279.1 vs. uniprot
Match: D8LTM6_ECTSI (Phosphodiesterase n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LTM6_ECTSI) HSP 1 Score: 76.3 bits (186), Expect = 5.980e-15 Identity = 34/50 (68.00%), Postives = 43/50 (86.00%), Query Frame = 1 Query: 1 SLAITYNDASVLENFHVAEAFKVLYDDPTNILEGLAQEEGRQFRQLVIKV 150 +LA YND SVLENFH++EAFKVLYD+ TNIL+GL+ ++ R FRQLVIK+ Sbjct: 401 ALATRYNDGSVLENFHISEAFKVLYDEETNILDGLSADDARHFRQLVIKI 450
BLAST of mRNA_H-elongata_contig103367.279.1 vs. uniprot
Match: A0A1R2AT59_9CILI (PDEase domain-containing protein n=1 Tax=Stentor coeruleus TaxID=5963 RepID=A0A1R2AT59_9CILI) HSP 1 Score: 63.5 bits (153), Expect = 1.760e-10 Identity = 29/48 (60.42%), Postives = 37/48 (77.08%), Query Frame = 1 Query: 1 SLAITYNDASVLENFHVAEAFKVLYDDPTNILEGLAQEEGRQFRQLVI 144 SLAI YND SVLENFHVA AFKVLY++ N +EG+ +E+ ++FR I Sbjct: 222 SLAIMYNDKSVLENFHVASAFKVLYEENNNFIEGVQKEDSKRFRMKCI 269
BLAST of mRNA_H-elongata_contig103367.279.1 vs. uniprot
Match: UPI000811645F (calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1C-like n=1 Tax=Rhagoletis zephyria TaxID=28612 RepID=UPI000811645F) HSP 1 Score: 61.6 bits (148), Expect = 8.510e-10 Identity = 26/49 (53.06%), Postives = 39/49 (79.59%), Query Frame = 1 Query: 4 LAITYNDASVLENFHVAEAFKVLYDDPTNILEGLAQEEGRQFRQLVIKV 150 + + YND SVLENFH++EAFKV+ D NI++ L++EE R+FR L+I++ Sbjct: 243 ITLLYNDRSVLENFHISEAFKVMRKDEANIIQNLSREEYREFRTLIIEM 291
BLAST of mRNA_H-elongata_contig103367.279.1 vs. uniprot
Match: A0A0G4GES2_9ALVE (Phosphodiesterase n=1 Tax=Chromera velia CCMP2878 TaxID=1169474 RepID=A0A0G4GES2_9ALVE) HSP 1 Score: 60.5 bits (145), Expect = 2.180e-9 Identity = 25/49 (51.02%), Postives = 37/49 (75.51%), Query Frame = 1 Query: 1 SLAITYNDASVLENFHVAEAFKVLYDDPTNILEGLAQEEGRQFRQLVIK 147 SLA+TYND ++LENFH AE F++L D N+ EG+ +E+ + FR LV++ Sbjct: 664 SLAVTYNDRAILENFHAAETFRILLSDRCNVTEGMVREDFQTFRALVLE 712
BLAST of mRNA_H-elongata_contig103367.279.1 vs. uniprot
Match: A0A6P6YES1_DERPT (Phosphodiesterase n=1 Tax=Dermatophagoides pteronyssinus TaxID=6956 RepID=A0A6P6YES1_DERPT) HSP 1 Score: 59.7 bits (143), Expect = 4.070e-9 Identity = 25/49 (51.02%), Postives = 39/49 (79.59%), Query Frame = 1 Query: 4 LAITYNDASVLENFHVAEAFKVLYDDPTNILEGLAQEEGRQFRQLVIKV 150 +++ YND SVLENFH++EAF+V+ D NI+ L++EE R+FR L+I++ Sbjct: 317 ISLLYNDRSVLENFHISEAFRVMRKDDANIVANLSREEYREFRSLIIEM 365
BLAST of mRNA_H-elongata_contig103367.279.1 vs. uniprot
Match: A0A6P6YG42_DERPT (Phosphodiesterase n=2 Tax=Dermatophagoides pteronyssinus TaxID=6956 RepID=A0A6P6YG42_DERPT) HSP 1 Score: 59.7 bits (143), Expect = 4.080e-9 Identity = 25/49 (51.02%), Postives = 39/49 (79.59%), Query Frame = 1 Query: 4 LAITYNDASVLENFHVAEAFKVLYDDPTNILEGLAQEEGRQFRQLVIKV 150 +++ YND SVLENFH++EAF+V+ D NI+ L++EE R+FR L+I++ Sbjct: 526 ISLLYNDRSVLENFHISEAFRVMRKDDANIVANLSREEYREFRSLIIEM 574
BLAST of mRNA_H-elongata_contig103367.279.1 vs. uniprot
Match: UPI001F104AC5 (calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1-like n=1 Tax=Dermatophagoides farinae TaxID=6954 RepID=UPI001F104AC5) HSP 1 Score: 59.3 bits (142), Expect = 5.560e-9 Identity = 25/49 (51.02%), Postives = 39/49 (79.59%), Query Frame = 1 Query: 4 LAITYNDASVLENFHVAEAFKVLYDDPTNILEGLAQEEGRQFRQLVIKV 150 +++ YND SVLENFH++EAF+V+ D NI+ L++EE R+FR L+I++ Sbjct: 216 ISLLYNDRSVLENFHISEAFRVIRKDDANIVANLSREEYREFRTLIIEM 264
BLAST of mRNA_H-elongata_contig103367.279.1 vs. uniprot
Match: UPI001FA17132 (Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1C n=1 Tax=Dermatophagoides farinae TaxID=6954 RepID=UPI001FA17132) HSP 1 Score: 59.3 bits (142), Expect = 5.580e-9 Identity = 25/49 (51.02%), Postives = 39/49 (79.59%), Query Frame = 1 Query: 4 LAITYNDASVLENFHVAEAFKVLYDDPTNILEGLAQEEGRQFRQLVIKV 150 +++ YND SVLENFH++EAF+V+ D NI+ L++EE R+FR L+I++ Sbjct: 962 ISLLYNDRSVLENFHISEAFRVIRKDDANIVANLSREEYREFRTLIIEM 1010
BLAST of mRNA_H-elongata_contig103367.279.1 vs. uniprot
Match: A0A2P6NGP8_9EUKA (Phosphodiesterase n=1 Tax=Planoprotostelium fungivorum TaxID=1890364 RepID=A0A2P6NGP8_9EUKA) HSP 1 Score: 58.9 bits (141), Expect = 7.630e-9 Identity = 25/47 (53.19%), Postives = 35/47 (74.47%), Query Frame = 1 Query: 4 LAITYNDASVLENFHVAEAFKVLYDDPTNILEGLAQEEGRQFRQLVI 144 LA+ YND SVLE+FHVA AFKVLY+D NI GL + + ++ R+ ++ Sbjct: 841 LAVRYNDRSVLESFHVASAFKVLYEDSNNIFSGLTEAQRKEARETIV 887
BLAST of mRNA_H-elongata_contig103367.279.1 vs. uniprot
Match: A0A7S1RHY1_ALECA (Hypothetical protein (Fragment) n=1 Tax=Alexandrium catenella TaxID=2925 RepID=A0A7S1RHY1_ALECA) HSP 1 Score: 55.8 bits (133), Expect = 1.840e-8 Identity = 27/48 (56.25%), Postives = 39/48 (81.25%), Query Frame = 1 Query: 4 LAITYNDASVLENFHVAEAFKVLYDDP-TNILEGLAQEEGRQFRQLVI 144 LA+TYND SVLEN+H+A+AFK+L++ P TNILE L+ +E + R+ +I Sbjct: 94 LALTYNDQSVLENYHIAQAFKLLFNCPDTNILESLSSDELSRARKEII 141 The following BLAST results are available for this feature:
BLAST of mRNA_H-elongata_contig103367.279.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25 ZOOMx 1POSITION0
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-elongata_contig103367.279.1 >prot_H-elongata_contig103367.279.1 ID=prot_H-elongata_contig103367.279.1|Name=mRNA_H-elongata_contig103367.279.1|organism=Himanthalia elongata Himel1 dioecious|type=polypeptide|length=50bp SLAITYNDASVLENFHVAEAFKVLYDDPTNILEGLAQEEGRQFRQLVIKVback to top mRNA from alignment at H-elongata_contig103367:457..606- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-elongata_contig103367.279.1 ID=mRNA_H-elongata_contig103367.279.1|Name=mRNA_H-elongata_contig103367.279.1|organism=Himanthalia elongata Himel1 dioecious|type=mRNA|length=150bp|location=Sequence derived from alignment at H-elongata_contig103367:457..606- (Himanthalia elongata Himel1 dioecious)back to top Coding sequence (CDS) from alignment at H-elongata_contig103367:457..606- >mRNA_H-elongata_contig103367.279.1 ID=mRNA_H-elongata_contig103367.279.1|Name=mRNA_H-elongata_contig103367.279.1|organism=Himanthalia elongata Himel1 dioecious|type=CDS|length=300bp|location=Sequence derived from alignment at H-elongata_contig103367:457..606- (Himanthalia elongata Himel1 dioecious)back to top |