mRNA_H-elongata_contig103094.259.1 (mRNA) Himanthalia elongata Himel1 dioecious
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_H-elongata_contig103094.259.1 vs. uniprot
Match: A0A210R0Z4_MIZYE (Tonsoku-like protein n=1 Tax=Mizuhopecten yessoensis TaxID=6573 RepID=A0A210R0Z4_MIZYE) HSP 1 Score: 57.0 bits (136), Expect = 1.080e-6 Identity = 25/58 (43.10%), Postives = 35/58 (60.34%), Query Frame = 1 Query: 1 RNEFAQTPLHKACESGNINVVQKLVQGGADTSAKDAAEDTPFHEACRHQYDSIMGYLM 174 RNE +T LHKAC SGN+ V+KL++ G + +D P HEA H + I+ YL+ Sbjct: 531 RNEKGETALHKACISGNLKKVKKLIEQGHPVNPRDYCGWIPLHEAANHDHSEIVSYLL 588
BLAST of mRNA_H-elongata_contig103094.259.1 vs. uniprot
Match: A2DIE2_TRIVA (Ankyrin repeat protein, putative n=1 Tax=Trichomonas vaginalis TaxID=5722 RepID=A2DIE2_TRIVA) HSP 1 Score: 53.1 bits (126), Expect = 1.160e-6 Identity = 29/68 (42.65%), Postives = 36/68 (52.94%), Query Frame = 1 Query: 4 NEFAQTPLHKACESGNINVVQKLVQGGADTSAKDAAEDTPFHEACRHQYDSIMGYLMTLDDNSESSKG 207 N QTPLH ACE GN+ VVQ L+ G T+AKD T + A R +Y I+ L D N + G Sbjct: 13 NTEKQTPLHIACEMGNVEVVQLLLSLGVQTAAKDVNGMTAYDFAKRSEYQDILDILNEYDVNKINEVG 80
BLAST of mRNA_H-elongata_contig103094.259.1 vs. uniprot
Match: UPI001E674012 (tonsoku-like protein n=1 Tax=Procambarus clarkii TaxID=6728 RepID=UPI001E674012) HSP 1 Score: 56.6 bits (135), Expect = 1.470e-6 Identity = 25/54 (46.30%), Postives = 34/54 (62.96%), Query Frame = 1 Query: 1 RNEFAQTPLHKACESGNINVVQKLVQGGADTSAKDAAEDTPFHEACRHQYDSIM 162 RNE +TPLHKAC GN+N+V+KL+Q G + +D P HEA H + I+ Sbjct: 518 RNEKGETPLHKACIDGNLNMVKKLLQQGHPVNPRDNCGWLPIHEAANHGFHDIV 571
BLAST of mRNA_H-elongata_contig103094.259.1 vs. uniprot
Match: T1J276_STRMM (Tonsoku-like protein n=1 Tax=Strigamia maritima TaxID=126957 RepID=T1J276_STRMM) HSP 1 Score: 54.7 bits (130), Expect = 6.700e-6 Identity = 23/58 (39.66%), Postives = 37/58 (63.79%), Query Frame = 1 Query: 1 RNEFAQTPLHKACESGNINVVQKLVQGGADTSAKDAAEDTPFHEACRHQYDSIMGYLM 174 +NE +T LH+AC +GNIN+V++L++ G + +D P HEA H + I+ YL+ Sbjct: 393 KNEKGETQLHRACITGNINMVRRLIEKGHPVNPRDNCGWIPLHEAANHDHYDIVEYLL 450
BLAST of mRNA_H-elongata_contig103094.259.1 vs. uniprot
Match: UPI0014032DBC (tonsoku-like protein n=1 Tax=Petromyzon marinus TaxID=7757 RepID=UPI0014032DBC) HSP 1 Score: 54.7 bits (130), Expect = 6.860e-6 Identity = 23/58 (39.66%), Postives = 35/58 (60.34%), Query Frame = 1 Query: 1 RNEFAQTPLHKACESGNINVVQKLVQGGADTSAKDAAEDTPFHEACRHQYDSIMGYLM 174 RNE +T LH+AC GN+ +V+ L++ G + +D P HEAC H + I+ YL+ Sbjct: 531 RNEKGETALHRACIEGNLRLVKILIEKGHPPNPRDYCGWLPLHEACNHNHQDIVEYLL 588
BLAST of mRNA_H-elongata_contig103094.259.1 vs. uniprot
Match: A0A814TAD2_9BILA (Hypothetical protein n=8 Tax=Rotaria sp. Silwood1 TaxID=2762511 RepID=A0A814TAD2_9BILA) HSP 1 Score: 53.9 bits (128), Expect = 1.190e-5 Identity = 25/58 (43.10%), Postives = 35/58 (60.34%), Query Frame = 1 Query: 19 TPLHKACESGNINVVQKLVQGGADTSAKDAAEDTPFHEACRHQYDSIMGYLMTLDDNS 192 TPL AC++G + +V+ L++ GAD D T A R YD+I+ YL+ LDDNS Sbjct: 161 TPLRLACDNGQLEMVEYLIENGADLYHTDKNNSTSLMVASRRGYDNIVQYLLKLDDNS 218
BLAST of mRNA_H-elongata_contig103094.259.1 vs. uniprot
Match: A0A1Y3MRS7_PIRSE (Uncharacterized protein (Fragment) n=1 Tax=Piromyces sp. (strain E2) TaxID=73868 RepID=A0A1Y3MRS7_PIRSE) HSP 1 Score: 50.1 bits (118), Expect = 1.900e-5 Identity = 21/47 (44.68%), Postives = 34/47 (72.34%), Query Frame = 1 Query: 19 TPLHKACESGNINVVQKLVQGGADTSAKDAAEDTPFHEACRHQYDSI 159 T LH ACE+G+ NVVQ L++ GA+ + + +TP H AC+++Y++I Sbjct: 1 TALHYACENGHENVVQYLIEQGANINKGNKGLETPLHIACKNKYENI 47
BLAST of mRNA_H-elongata_contig103094.259.1 vs. uniprot
Match: UPI001C9B5883 (rabankyrin-5 isoform X1 n=3 Tax=Colletes gigas TaxID=935657 RepID=UPI001C9B5883) HSP 1 Score: 53.1 bits (126), Expect = 2.310e-5 Identity = 27/67 (40.30%), Postives = 40/67 (59.70%), Query Frame = 1 Query: 19 TPLHKACESGNINVVQKLVQGGADTSAKDAAEDTPFHEACRHQYDSIMGYLM---TLDDNSESSKGL 210 TPLH C+ G VVQ L++ GA+ +A+DA TP H A ++Q+ I+ L+ ++D N KGL Sbjct: 727 TPLHLCCQWGLEQVVQTLIEHGANVNARDAEGKTPVHVAIQNQHSQIISLLLCHPSIDLNKRDKKGL 793
BLAST of mRNA_H-elongata_contig103094.259.1 vs. uniprot
Match: A0A0C9RRB6_9HYME (Ankfy1 protein (Fragment) n=1 Tax=Fopius arisanus TaxID=64838 RepID=A0A0C9RRB6_9HYME) HSP 1 Score: 52.8 bits (125), Expect = 3.070e-5 Identity = 27/66 (40.91%), Postives = 41/66 (62.12%), Query Frame = 1 Query: 19 TPLHKACESGNINVVQKLVQGGADTSAKDAAEDTPFHEACRHQYDSIMGYLM---TLDDNSESSKG 207 TPLH C+ G VVQ LV+ GA+ +A+DA TP H A ++Q++ I+ L+ ++D +S KG Sbjct: 502 TPLHLCCQWGLEQVVQTLVEHGANVNARDAEGKTPIHVAIQNQHEQIISLLLCHPSIDLSSRDKKG 567
BLAST of mRNA_H-elongata_contig103094.259.1 vs. uniprot
Match: UPI0005ACA9DD (rabankyrin-5 n=1 Tax=Fopius arisanus TaxID=64838 RepID=UPI0005ACA9DD) HSP 1 Score: 52.8 bits (125), Expect = 3.150e-5 Identity = 27/66 (40.91%), Postives = 41/66 (62.12%), Query Frame = 1 Query: 19 TPLHKACESGNINVVQKLVQGGADTSAKDAAEDTPFHEACRHQYDSIMGYLM---TLDDNSESSKG 207 TPLH C+ G VVQ LV+ GA+ +A+DA TP H A ++Q++ I+ L+ ++D +S KG Sbjct: 732 TPLHLCCQWGLEQVVQTLVEHGANVNARDAEGKTPIHVAIQNQHEQIISLLLCHPSIDLSSRDKKG 797 The following BLAST results are available for this feature:
BLAST of mRNA_H-elongata_contig103094.259.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 14 ZOOMx 1POSITION0
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-elongata_contig103094.259.1 >prot_H-elongata_contig103094.259.1 ID=prot_H-elongata_contig103094.259.1|Name=mRNA_H-elongata_contig103094.259.1|organism=Himanthalia elongata Himel1 dioecious|type=polypeptide|length=141bp RNEFAQTPLHKACESGNINVVQKLVQGGADTSAKDAAEDTPFHEACRHQYback to top mRNA from alignment at H-elongata_contig103094:656..1775+ Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-elongata_contig103094.259.1 ID=mRNA_H-elongata_contig103094.259.1|Name=mRNA_H-elongata_contig103094.259.1|organism=Himanthalia elongata Himel1 dioecious|type=mRNA|length=1120bp|location=Sequence derived from alignment at H-elongata_contig103094:656..1775+ (Himanthalia elongata Himel1 dioecious)back to top Coding sequence (CDS) from alignment at H-elongata_contig103094:656..1775+ >mRNA_H-elongata_contig103094.259.1 ID=mRNA_H-elongata_contig103094.259.1|Name=mRNA_H-elongata_contig103094.259.1|organism=Himanthalia elongata Himel1 dioecious|type=CDS|length=846bp|location=Sequence derived from alignment at H-elongata_contig103094:656..1775+ (Himanthalia elongata Himel1 dioecious)back to top |