mRNA_H-elongata_contig103050.256.1 (mRNA) Himanthalia elongata Himel1 dioecious
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_H-elongata_contig103050.256.1 vs. uniprot
Match: D8LPY7_ECTSI (Helicase ATP-binding domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LPY7_ECTSI) HSP 1 Score: 73.9 bits (180), Expect = 5.300e-14 Identity = 33/39 (84.62%), Postives = 36/39 (92.31%), Query Frame = 1 Query: 55 DPEIPFPFEPYLVQKQLMRKIYITLERGGVGIFESPTGT 171 +P+IPFPFEPY VQKQLMRKIY TLE GG+GIFESPTGT Sbjct: 20 EPDIPFPFEPYDVQKQLMRKIYSTLENGGIGIFESPTGT 58
BLAST of mRNA_H-elongata_contig103050.256.1 vs. uniprot
Match: A0A835YWY4_9STRA (Helicase C-terminal domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YWY4_9STRA) HSP 1 Score: 64.3 bits (155), Expect = 1.300e-10 Identity = 31/54 (57.41%), Postives = 37/54 (68.52%), Query Frame = 1 Query: 16 ILTDEVGKSDGGLD--PEIPFPFEPYLVQKQLMRKIYITLERGGVGIFESPTGT 171 +L D S+G + P IPFPF PY VQ+QLM +Y ERGG+GIFESPTGT Sbjct: 1 MLADAQQNSEGDMTFVPSIPFPFPPYEVQQQLMTHLYTAFERGGIGIFESPTGT 54
BLAST of mRNA_H-elongata_contig103050.256.1 vs. uniprot
Match: A0A7S0NLH8_MICPS (Hypothetical protein (Fragment) n=1 Tax=Micromonas pusilla TaxID=38833 RepID=A0A7S0NLH8_MICPS) HSP 1 Score: 58.5 bits (140), Expect = 1.340e-8 Identity = 25/34 (73.53%), Postives = 29/34 (85.29%), Query Frame = 1 Query: 70 FPFEPYLVQKQLMRKIYITLERGGVGIFESPTGT 171 FPFEPY +Q LMR +Y TLERGG+G+FESPTGT Sbjct: 31 FPFEPYPIQLDLMRGLYRTLERGGIGVFESPTGT 64
BLAST of mRNA_H-elongata_contig103050.256.1 vs. uniprot
Match: UPI0018CFF1EB (ATP-dependent DNA helicase DDX11-like n=1 Tax=Plutella xylostella TaxID=51655 RepID=UPI0018CFF1EB) HSP 1 Score: 58.5 bits (140), Expect = 1.420e-8 Identity = 23/37 (62.16%), Postives = 33/37 (89.19%), Query Frame = 1 Query: 61 EIPFPFEPYLVQKQLMRKIYITLERGGVGIFESPTGT 171 E PFPF+PY +Q++ M+++Y+TLE+ G+GIFESPTGT Sbjct: 5 EFPFPFKPYDIQQKFMKELYLTLEKRGLGIFESPTGT 41
BLAST of mRNA_H-elongata_contig103050.256.1 vs. uniprot
Match: A0A556U148_BAGYA (ATP-dependent DNA helicase DDX11 n=1 Tax=Bagarius yarrelli TaxID=175774 RepID=A0A556U148_BAGYA) HSP 1 Score: 58.2 bits (139), Expect = 1.930e-8 Identity = 25/43 (58.14%), Postives = 31/43 (72.09%), Query Frame = 1 Query: 43 DGGLDPEIPFPFEPYLVQKQLMRKIYITLERGGVGIFESPTGT 171 DG + PFPF PY +Q++ M +YI LE+G VGIFESPTGT Sbjct: 3 DGNGESRFPFPFNPYPIQERFMEALYIVLEQGKVGIFESPTGT 45
BLAST of mRNA_H-elongata_contig103050.256.1 vs. uniprot
Match: UPI000907367C (ATP-dependent DNA helicase DDX11 isoform X5 n=1 Tax=Alligator mississippiensis TaxID=8496 RepID=UPI000907367C) HSP 1 Score: 58.2 bits (139), Expect = 1.940e-8 Identity = 27/47 (57.45%), Postives = 33/47 (70.21%), Query Frame = 1 Query: 31 VGKSDGGLDPEIPFPFEPYLVQKQLMRKIYITLERGGVGIFESPTGT 171 VG +GG+ PFPF PY +Q++ M +Y LE GGVGIFESPTGT Sbjct: 55 VGAREGGV--RFPFPFAPYRIQEEFMAALYRALEAGGVGIFESPTGT 99
BLAST of mRNA_H-elongata_contig103050.256.1 vs. uniprot
Match: A0A5B8MRF8_9CHLO (DNA helicase n=2 Tax=Chloropicon primus TaxID=1764295 RepID=A0A5B8MRF8_9CHLO) HSP 1 Score: 58.2 bits (139), Expect = 1.940e-8 Identity = 26/34 (76.47%), Postives = 28/34 (82.35%), Query Frame = 1 Query: 70 FPFEPYLVQKQLMRKIYITLERGGVGIFESPTGT 171 FPFEPY VQK LMR +Y TLE GGVG+ ESPTGT Sbjct: 14 FPFEPYDVQKDLMRAVYRTLEHGGVGVLESPTGT 47
BLAST of mRNA_H-elongata_contig103050.256.1 vs. uniprot
Match: A0A6P3X819_DINQU (probable ATP-dependent RNA helicase DDX11 isoform X1 n=2 Tax=Dinoponera quadriceps TaxID=609295 RepID=A0A6P3X819_DINQU) HSP 1 Score: 58.2 bits (139), Expect = 1.940e-8 Identity = 24/37 (64.86%), Postives = 30/37 (81.08%), Query Frame = 1 Query: 61 EIPFPFEPYLVQKQLMRKIYITLERGGVGIFESPTGT 171 E PFPF PY +QKQ M+++Y LE GG+G+FESPTGT Sbjct: 6 EFPFPFPPYEIQKQFMKELYNCLESGGLGLFESPTGT 42
BLAST of mRNA_H-elongata_contig103050.256.1 vs. uniprot
Match: A0A151NIF8_ALLMI (Putative ATP-dependent RNA helicase DDX11 isoform B n=4 Tax=Alligator TaxID=8495 RepID=A0A151NIF8_ALLMI) HSP 1 Score: 58.2 bits (139), Expect = 1.940e-8 Identity = 27/47 (57.45%), Postives = 33/47 (70.21%), Query Frame = 1 Query: 31 VGKSDGGLDPEIPFPFEPYLVQKQLMRKIYITLERGGVGIFESPTGT 171 VG +GG+ PFPF PY +Q++ M +Y LE GGVGIFESPTGT Sbjct: 9 VGAREGGV--RFPFPFAPYRIQEEFMAALYRALEAGGVGIFESPTGT 53
BLAST of mRNA_H-elongata_contig103050.256.1 vs. uniprot
Match: UPI0009073E1F (ATP-dependent DNA helicase DDX11 isoform X1 n=4 Tax=Alligator mississippiensis TaxID=8496 RepID=UPI0009073E1F) HSP 1 Score: 58.2 bits (139), Expect = 1.940e-8 Identity = 27/47 (57.45%), Postives = 33/47 (70.21%), Query Frame = 1 Query: 31 VGKSDGGLDPEIPFPFEPYLVQKQLMRKIYITLERGGVGIFESPTGT 171 VG +GG+ PFPF PY +Q++ M +Y LE GGVGIFESPTGT Sbjct: 55 VGAREGGV--RFPFPFAPYRIQEEFMAALYRALEAGGVGIFESPTGT 99 The following BLAST results are available for this feature:
BLAST of mRNA_H-elongata_contig103050.256.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25 ZOOMx 1POSITION0
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-elongata_contig103050.256.1 >prot_H-elongata_contig103050.256.1 ID=prot_H-elongata_contig103050.256.1|Name=mRNA_H-elongata_contig103050.256.1|organism=Himanthalia elongata Himel1 dioecious|type=polypeptide|length=56bp MSLNILTDEVGKSDGGLDPEIPFPFEPYLVQKQLMRKIYITLERGGVGIFback to top mRNA from alignment at H-elongata_contig103050:1445..1615+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-elongata_contig103050.256.1 ID=mRNA_H-elongata_contig103050.256.1|Name=mRNA_H-elongata_contig103050.256.1|organism=Himanthalia elongata Himel1 dioecious|type=mRNA|length=171bp|location=Sequence derived from alignment at H-elongata_contig103050:1445..1615+ (Himanthalia elongata Himel1 dioecious)back to top Coding sequence (CDS) from alignment at H-elongata_contig103050:1445..1615+ >mRNA_H-elongata_contig103050.256.1 ID=mRNA_H-elongata_contig103050.256.1|Name=mRNA_H-elongata_contig103050.256.1|organism=Himanthalia elongata Himel1 dioecious|type=CDS|length=336bp|location=Sequence derived from alignment at H-elongata_contig103050:1445..1615+ (Himanthalia elongata Himel1 dioecious)back to top |