mRNA_H-elongata_contig102372.207.1 (mRNA) Himanthalia elongata Himel1 dioecious
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_H-elongata_contig102372.207.1 vs. uniprot
Match: D7G5T1_ECTSI (Oxidoreductase n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G5T1_ECTSI) HSP 1 Score: 75.5 bits (184), Expect = 6.490e-15 Identity = 30/38 (78.95%), Postives = 33/38 (86.84%), Query Frame = 1 Query: 1 NQHQTSLWNGAVASGRTPKAIPRNAKGCVDCGSCLHGC 114 NQHQ+SLWNGA ASGR P+A+P N K CVDCGSCLHGC Sbjct: 544 NQHQSSLWNGAAASGRVPRAVPTNTKDCVDCGSCLHGC 581
BLAST of mRNA_H-elongata_contig102372.207.1 vs. uniprot
Match: A0A6H5JQQ5_9PHAE (4Fe-4S ferredoxin-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JQQ5_9PHAE) HSP 1 Score: 75.1 bits (183), Expect = 8.890e-15 Identity = 30/38 (78.95%), Postives = 33/38 (86.84%), Query Frame = 1 Query: 1 NQHQTSLWNGAVASGRTPKAIPRNAKGCVDCGSCLHGC 114 NQHQ+SLWNGA ASGR P+A+P N K CVDCGSCLHGC Sbjct: 636 NQHQSSLWNGAAASGRVPRAVPTNTKECVDCGSCLHGC 673
BLAST of mRNA_H-elongata_contig102372.207.1 vs. uniprot
Match: A0A482V3E7_9ARCH (GMC_OxRdtase_N domain-containing protein n=1 Tax=archaeon TaxID=1906665 RepID=A0A482V3E7_9ARCH) HSP 1 Score: 58.9 bits (141), Expect = 3.030e-10 Identity = 24/38 (63.16%), Postives = 27/38 (71.05%), Query Frame = 1 Query: 1 NQHQTSLWNGAVASGRTPKAIPRNAKGCVDCGSCLHGC 114 N++ LW GAV SG TP+ IPRN KGCVDCG C GC Sbjct: 14 NENNRFLWQGAVKSGYTPEKIPRNVKGCVDCGHCCFGC 51
BLAST of mRNA_H-elongata_contig102372.207.1 vs. uniprot
Match: A0A7S1UJN9_9STRA (Long-chain-alcohol oxidase n=1 Tax=Phaeomonas parva TaxID=124430 RepID=A0A7S1UJN9_9STRA) HSP 1 Score: 49.3 bits (116), Expect = 1.110e-5 Identity = 21/32 (65.62%), Postives = 23/32 (71.88%), Query Frame = 1 Query: 19 LWNGAVASGRTPKAIPRNAKGCVDCGSCLHGC 114 L GA A G +A+PRN KGCVDCGSC HGC Sbjct: 443 LVEGAHALGMPCRAVPRNVKGCVDCGSCSHGC 474
BLAST of mRNA_H-elongata_contig102372.207.1 vs. uniprot
Match: A0A7R9YDU7_9STRA (Hypothetical protein (Fragment) n=1 Tax=Pinguiococcus pyrenoidosus TaxID=172671 RepID=A0A7R9YDU7_9STRA) HSP 1 Score: 47.0 bits (110), Expect = 7.290e-5 Identity = 20/38 (52.63%), Postives = 25/38 (65.79%), Query Frame = 1 Query: 1 NQHQTSLWNGAVASGRTPKAIPRNAKGCVDCGSCLHGC 114 N++ L GA + G +A+PRN KGCVDCGSC GC Sbjct: 346 NKNNDFLVEGAYSLGMKCRAVPRNVKGCVDCGSCNFGC 383 The following BLAST results are available for this feature:
BLAST of mRNA_H-elongata_contig102372.207.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 5 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-elongata_contig102372.207.1 >prot_H-elongata_contig102372.207.1 ID=prot_H-elongata_contig102372.207.1|Name=mRNA_H-elongata_contig102372.207.1|organism=Himanthalia elongata Himel1 dioecious|type=polypeptide|length=38bp NQHQTSLWNGAVASGRTPKAIPRNAKGCVDCGSCLHGCback to top mRNA from alignment at H-elongata_contig102372:282..395- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-elongata_contig102372.207.1 ID=mRNA_H-elongata_contig102372.207.1|Name=mRNA_H-elongata_contig102372.207.1|organism=Himanthalia elongata Himel1 dioecious|type=mRNA|length=114bp|location=Sequence derived from alignment at H-elongata_contig102372:282..395- (Himanthalia elongata Himel1 dioecious)back to top Coding sequence (CDS) from alignment at H-elongata_contig102372:282..395- >mRNA_H-elongata_contig102372.207.1 ID=mRNA_H-elongata_contig102372.207.1|Name=mRNA_H-elongata_contig102372.207.1|organism=Himanthalia elongata Himel1 dioecious|type=CDS|length=228bp|location=Sequence derived from alignment at H-elongata_contig102372:282..395- (Himanthalia elongata Himel1 dioecious)back to top |