mRNA_H-elongata_contig102085.190.1 (mRNA) Himanthalia elongata Himel1 dioecious
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_H-elongata_contig102085.190.1 vs. uniprot
Match: A0A3R6WYV0_9STRA (Uncharacterized protein n=4 Tax=Aphanomyces astaci TaxID=112090 RepID=A0A3R6WYV0_9STRA) HSP 1 Score: 51.2 bits (121), Expect = 1.670e-6 Identity = 17/35 (48.57%), Postives = 26/35 (74.29%), Query Frame = 1 Query: 1 IKVHALIRHGARTPSTAPKCWQGYNITWNCNVTEV 105 ++V ++RHGARTP + KCW GY+ WNC++ E+ Sbjct: 52 VQVQVVVRHGARTPWSGKKCWDGYDEEWNCSIREL 86
BLAST of mRNA_H-elongata_contig102085.190.1 vs. uniprot
Match: A0A485LM95_9STRA (Aste57867_23089 protein n=1 Tax=Aphanomyces stellatus TaxID=120398 RepID=A0A485LM95_9STRA) HSP 1 Score: 52.0 bits (123), Expect = 1.950e-6 Identity = 18/35 (51.43%), Postives = 27/35 (77.14%), Query Frame = 1 Query: 1 IKVHALIRHGARTPSTAPKCWQGYNITWNCNVTEV 105 I+V ++RHGARTP +A +CW GYN WNC++ ++ Sbjct: 49 IQVQLVVRHGARTPWSANRCWDGYNEEWNCSIRQL 83
BLAST of mRNA_H-elongata_contig102085.190.1 vs. uniprot
Match: A0A6A5A2U3_9STRA (Uncharacterized protein n=1 Tax=Aphanomyces astaci TaxID=112090 RepID=A0A6A5A2U3_9STRA) HSP 1 Score: 51.2 bits (121), Expect = 3.640e-6 Identity = 17/35 (48.57%), Postives = 26/35 (74.29%), Query Frame = 1 Query: 1 IKVHALIRHGARTPSTAPKCWQGYNITWNCNVTEV 105 ++V ++RHGARTP + KCW GY+ WNC++ E+ Sbjct: 52 VQVQVVVRHGARTPWSGKKCWDGYDEEWNCSIREL 86
BLAST of mRNA_H-elongata_contig102085.190.1 vs. uniprot
Match: A0A397FC07_9STRA (Uncharacterized protein n=1 Tax=Aphanomyces astaci TaxID=112090 RepID=A0A397FC07_9STRA) HSP 1 Score: 51.2 bits (121), Expect = 3.640e-6 Identity = 17/35 (48.57%), Postives = 26/35 (74.29%), Query Frame = 1 Query: 1 IKVHALIRHGARTPSTAPKCWQGYNITWNCNVTEV 105 ++V ++RHGARTP + KCW GY+ WNC++ E+ Sbjct: 52 VQVQVVVRHGARTPWSGKKCWDGYDEEWNCSIREL 86
BLAST of mRNA_H-elongata_contig102085.190.1 vs. uniprot
Match: W4H559_9STRA (Uncharacterized protein n=10 Tax=Aphanomyces astaci TaxID=112090 RepID=W4H559_9STRA) HSP 1 Score: 51.2 bits (121), Expect = 3.650e-6 Identity = 17/35 (48.57%), Postives = 26/35 (74.29%), Query Frame = 1 Query: 1 IKVHALIRHGARTPSTAPKCWQGYNITWNCNVTEV 105 ++V ++RHGARTP + KCW GY+ WNC++ E+ Sbjct: 52 VQVQVVVRHGARTPWSGKKCWDGYDEEWNCSIREL 86
BLAST of mRNA_H-elongata_contig102085.190.1 vs. uniprot
Match: A0A1W0AC86_9STRA (Uncharacterized protein (Fragment) n=1 Tax=Thraustotheca clavata TaxID=74557 RepID=A0A1W0AC86_9STRA) HSP 1 Score: 50.1 bits (118), Expect = 9.400e-6 Identity = 19/39 (48.72%), Postives = 28/39 (71.79%), Query Frame = 1 Query: 4 KVHALIRHGARTPSTAPKCWQGYNITWNCNVTE-VGPLL 117 +V ++RHGARTP ++ KCW GYN W CN+ + + P+L Sbjct: 2198 QVQIMVRHGARTPWSSGKCWDGYNEVWTCNLRDQMAPVL 2236
BLAST of mRNA_H-elongata_contig102085.190.1 vs. uniprot
Match: A0A067BR41_SAPPC (Uncharacterized protein n=3 Tax=Saprolegnia TaxID=4769 RepID=A0A067BR41_SAPPC) HSP 1 Score: 49.7 bits (117), Expect = 1.280e-5 Identity = 20/38 (52.63%), Postives = 26/38 (68.42%), Query Frame = 1 Query: 7 VHALIRHGARTPSTAPKCWQGYNITWNCNVTE-VGPLL 117 V L+RHGARTP + KCW GYN WNC + + + P+L Sbjct: 55 VQLLVRHGARTPYSWQKCWNGYNEAWNCQLRDRMAPVL 92
BLAST of mRNA_H-elongata_contig102085.190.1 vs. uniprot
Match: A0A485LIC2_9STRA (Aste57867_21261 protein n=1 Tax=Aphanomyces stellatus TaxID=120398 RepID=A0A485LIC2_9STRA) HSP 1 Score: 48.9 bits (115), Expect = 2.390e-5 Identity = 17/35 (48.57%), Postives = 24/35 (68.57%), Query Frame = 1 Query: 1 IKVHALIRHGARTPSTAPKCWQGYNITWNCNVTEV 105 ++V ++RHGAR P A KCW+ Y+ WNCN E+ Sbjct: 44 VQVQLVVRHGARAPCFADKCWKEYDEEWNCNAREI 78
BLAST of mRNA_H-elongata_contig102085.190.1 vs. uniprot
Match: A0A1V9Z1L0_9STRA (Uncharacterized protein n=1 Tax=Achlya hypogyna TaxID=1202772 RepID=A0A1V9Z1L0_9STRA) HSP 1 Score: 48.9 bits (115), Expect = 2.400e-5 Identity = 19/40 (47.50%), Postives = 28/40 (70.00%), Query Frame = 1 Query: 1 IKVHALIRHGARTPSTAPKCWQGYNITWNCNVTE-VGPLL 117 + V L+RHGARTP + KCW GY+ WNC++ + + P+L Sbjct: 51 VHVQLLVRHGARTPYSWQKCWNGYSEAWNCSLRDRMAPVL 90
BLAST of mRNA_H-elongata_contig102085.190.1 vs. uniprot
Match: A0A1W0A9T9_9STRA (Uncharacterized protein n=1 Tax=Thraustotheca clavata TaxID=74557 RepID=A0A1W0A9T9_9STRA) HSP 1 Score: 48.5 bits (114), Expect = 3.280e-5 Identity = 18/35 (51.43%), Postives = 26/35 (74.29%), Query Frame = 1 Query: 16 LIRHGARTPSTAPKCWQGYNITWNCNVTE-VGPLL 117 ++RHGARTP ++ KCW GYN W CN+ + + P+L Sbjct: 10 MVRHGARTPWSSGKCWDGYNEVWTCNLRDQMAPVL 44 The following BLAST results are available for this feature:
BLAST of mRNA_H-elongata_contig102085.190.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 10 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-elongata_contig102085.190.1 >prot_H-elongata_contig102085.190.1 ID=prot_H-elongata_contig102085.190.1|Name=mRNA_H-elongata_contig102085.190.1|organism=Himanthalia elongata Himel1 dioecious|type=polypeptide|length=48bp IKVHALIRHGARTPSTAPKCWQGYNITWNCNVTEVGPLLLSLRRQRV*back to top mRNA from alignment at H-elongata_contig102085:2154..2297+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-elongata_contig102085.190.1 ID=mRNA_H-elongata_contig102085.190.1|Name=mRNA_H-elongata_contig102085.190.1|organism=Himanthalia elongata Himel1 dioecious|type=mRNA|length=144bp|location=Sequence derived from alignment at H-elongata_contig102085:2154..2297+ (Himanthalia elongata Himel1 dioecious)back to top Coding sequence (CDS) from alignment at H-elongata_contig102085:2154..2297+ >mRNA_H-elongata_contig102085.190.1 ID=mRNA_H-elongata_contig102085.190.1|Name=mRNA_H-elongata_contig102085.190.1|organism=Himanthalia elongata Himel1 dioecious|type=CDS|length=288bp|location=Sequence derived from alignment at H-elongata_contig102085:2154..2297+ (Himanthalia elongata Himel1 dioecious)back to top |