mRNA_H-elongata_contig101943.173.1 (mRNA) Himanthalia elongata Himel1 dioecious
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_H-elongata_contig101943.173.1 vs. uniprot
Match: A0A3S4Q8K1_9ACAR (Retrovirus-related Pol polyprotein from transposon TNT 1-94-like protein (Fragment) n=1 Tax=Dinothrombium tinctorium TaxID=1965070 RepID=A0A3S4Q8K1_9ACAR) HSP 1 Score: 55.5 bits (132), Expect = 1.300e-6 Identity = 28/85 (32.94%), Postives = 50/85 (58.82%), Query Frame = 1 Query: 70 WVTDSGFSRFMTPSADYMVNYR--EGGGVVRIADGRVMPIEGTGNLPMSFWSGKDWVKAILPNVAHVPLLGYNLLSLKMMDDRGH 318 W+ DSG S ++ +++ +++ E +RIA+ +V+ +EG GN+ + + GK W A + NV +VP G NL S+ D+G+ Sbjct: 10 WIADSGASEHISFHKEWLQDFKPIETKRELRIANNKVINVEGVGNILATVFDGKRWSNATIYNVLYVPESGVNLFSIGAAADKGY 94
BLAST of mRNA_H-elongata_contig101943.173.1 vs. uniprot
Match: A0A1B6E9D0_9HEMI (Uncharacterized protein (Fragment) n=1 Tax=Clastoptera arizonana TaxID=38151 RepID=A0A1B6E9D0_9HEMI) HSP 1 Score: 52.0 bits (123), Expect = 2.180e-5 Identity = 26/82 (31.71%), Postives = 47/82 (57.32%), Query Frame = 1 Query: 70 WVTDSGFSRFMTPSADYMVNYREGGGVVRIADGRVMPIEGTGNLPMSFWSGKDWVKAILPNVAHVPLLGYNLLSLKMMDDRG 315 W DSG + M+P + N+R+ ++IA+ ++ EG G++ + + + L NV++VP L NLLS+K++ D+G Sbjct: 289 WYLDSGATVHMSPHKHLIKNFRQSSKGIKIANKEIIQTEGQGDIEIKVKLKNEVRQIKLKNVSYVPQLAANLLSIKVLTDKG 370 The following BLAST results are available for this feature:
BLAST of mRNA_H-elongata_contig101943.173.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-elongata_contig101943.173.1 >prot_H-elongata_contig101943.173.1 ID=prot_H-elongata_contig101943.173.1|Name=mRNA_H-elongata_contig101943.173.1|organism=Himanthalia elongata Himel1 dioecious|type=polypeptide|length=109bp MAIEVEKNVLPVGELSLEAMVKRWVTDSGFSRFMTPSADYMVNYREGGGVback to top mRNA from alignment at H-elongata_contig101943:303..629- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-elongata_contig101943.173.1 ID=mRNA_H-elongata_contig101943.173.1|Name=mRNA_H-elongata_contig101943.173.1|organism=Himanthalia elongata Himel1 dioecious|type=mRNA|length=327bp|location=Sequence derived from alignment at H-elongata_contig101943:303..629- (Himanthalia elongata Himel1 dioecious)back to top Coding sequence (CDS) from alignment at H-elongata_contig101943:303..629- >mRNA_H-elongata_contig101943.173.1 ID=mRNA_H-elongata_contig101943.173.1|Name=mRNA_H-elongata_contig101943.173.1|organism=Himanthalia elongata Himel1 dioecious|type=CDS|length=654bp|location=Sequence derived from alignment at H-elongata_contig101943:303..629- (Himanthalia elongata Himel1 dioecious)back to top |