mRNA_H-elongata_contig101863.161.1 (mRNA) Himanthalia elongata Himel1 dioecious
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_H-elongata_contig101863.161.1 vs. uniprot
Match: D7FQG8_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FQG8_ECTSI) HSP 1 Score: 84.3 bits (207), Expect = 1.020e-17 Identity = 37/51 (72.55%), Postives = 42/51 (82.35%), Query Frame = 1 Query: 10 QAVENYGDRNWRHVAQTVGTRTHIQCQQRWKKALRPGLVKGAWSLEEDENL 162 +AVE G++NWR VA V TR HIQCQQRWKKALRPGLVKGAW +EED+ L Sbjct: 299 EAVEELGEKNWREVADHVRTRNHIQCQQRWKKALRPGLVKGAWGVEEDKKL 349
BLAST of mRNA_H-elongata_contig101863.161.1 vs. uniprot
Match: A0A6H5K458_9PHAE (MYB protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K458_9PHAE) HSP 1 Score: 84.0 bits (206), Expect = 1.320e-17 Identity = 38/54 (70.37%), Postives = 43/54 (79.63%), Query Frame = 1 Query: 1 MEWQAVENYGDRNWRHVAQTVGTRTHIQCQQRWKKALRPGLVKGAWSLEEDENL 162 +E AVE G++NWR VA V TR HIQCQQRWKKALRPGLVKGAW +EED+ L Sbjct: 382 VEKGAVEELGEKNWRQVADHVRTRNHIQCQQRWKKALRPGLVKGAWGVEEDKKL 435
BLAST of mRNA_H-elongata_contig101863.161.1 vs. uniprot
Match: A0A7S2UU49_9STRA (Hypothetical protein (Fragment) n=1 Tax=Fibrocapsa japonica TaxID=94617 RepID=A0A7S2UU49_9STRA) HSP 1 Score: 74.7 bits (182), Expect = 1.860e-14 Identity = 31/50 (62.00%), Postives = 37/50 (74.00%), Query Frame = 1 Query: 13 AVENYGDRNWRHVAQTVGTRTHIQCQQRWKKALRPGLVKGAWSLEEDENL 162 AV YG+ NW+ +A+ VGTR H+QC QRWKK L+PGLVKG WS ED L Sbjct: 41 AVRKYGESNWKDIAREVGTRNHVQCLQRWKKVLKPGLVKGQWSALEDAKL 90
BLAST of mRNA_H-elongata_contig101863.161.1 vs. uniprot
Match: A0A7S2BP72_9STRA (Hypothetical protein (Fragment) n=1 Tax=Florenciella parvula TaxID=236787 RepID=A0A7S2BP72_9STRA) HSP 1 Score: 70.1 bits (170), Expect = 2.940e-14 Identity = 28/50 (56.00%), Postives = 38/50 (76.00%), Query Frame = 1 Query: 13 AVENYGDRNWRHVAQTVGTRTHIQCQQRWKKALRPGLVKGAWSLEEDENL 162 AV+ +G+ NW+ +A+ V +R H+QC QRWKK L+PGLVKG WS +ED L Sbjct: 47 AVKEFGEVNWKAIAERVASRNHVQCLQRWKKVLKPGLVKGQWSAQEDAML 96
BLAST of mRNA_H-elongata_contig101863.161.1 vs. uniprot
Match: A0A7S3V2K8_9STRA (Hypothetical protein n=1 Tax=Aplanochytrium stocchinoi TaxID=215587 RepID=A0A7S3V2K8_9STRA) HSP 1 Score: 73.9 bits (180), Expect = 4.600e-14 Identity = 31/51 (60.78%), Postives = 41/51 (80.39%), Query Frame = 1 Query: 10 QAVENYGDRNWRHVAQTVGTRTHIQCQQRWKKALRPGLVKGAWSLEEDENL 162 +AV+ YGD+NWR VA+ + R++IQC QRWKK+LRPGL+KG W+ EED L Sbjct: 81 EAVKIYGDKNWRQVAKYIPGRSYIQCLQRWKKSLRPGLIKGHWTKEEDSKL 131
BLAST of mRNA_H-elongata_contig101863.161.1 vs. uniprot
Match: A0A0P1ANL8_PLAHL (Myb-like dna-binding n=1 Tax=Plasmopara halstedii TaxID=4781 RepID=A0A0P1ANL8_PLAHL) HSP 1 Score: 73.6 bits (179), Expect = 6.330e-14 Identity = 31/51 (60.78%), Postives = 36/51 (70.59%), Query Frame = 1 Query: 10 QAVENYGDRNWRHVAQTVGTRTHIQCQQRWKKALRPGLVKGAWSLEEDENL 162 +AVE +G RNW+ +A VG R H QC QRW K L+PGLVKG WS EED L Sbjct: 187 KAVEEFGQRNWKAIASRVGGRNHAQCLQRWNKVLKPGLVKGHWSFEEDSTL 237
BLAST of mRNA_H-elongata_contig101863.161.1 vs. uniprot
Match: A0A7S2T9W3_PROMC (Hypothetical protein (Fragment) n=1 Tax=Prorocentrum micans TaxID=2945 RepID=A0A7S2T9W3_PROMC) HSP 1 Score: 67.8 bits (164), Expect = 1.820e-13 Identity = 28/51 (54.90%), Postives = 36/51 (70.59%), Query Frame = 1 Query: 10 QAVENYGDRNWRHVAQTVGTRTHIQCQQRWKKALRPGLVKGAWSLEEDENL 162 +AV+ Y NW+ +A V R H+QC QRWKK L+PGLVKG W+ EED+ L Sbjct: 24 KAVDKYSASNWKAIADHVDGRNHVQCLQRWKKVLQPGLVKGMWAQEEDDTL 74
BLAST of mRNA_H-elongata_contig101863.161.1 vs. uniprot
Match: A0A7S2TCJ0_PROMC (Hypothetical protein n=2 Tax=Sar TaxID=2698737 RepID=A0A7S2TCJ0_PROMC) HSP 1 Score: 72.0 bits (175), Expect = 2.200e-13 Identity = 30/50 (60.00%), Postives = 39/50 (78.00%), Query Frame = 1 Query: 13 AVENYGDRNWRHVAQTVGTRTHIQCQQRWKKALRPGLVKGAWSLEEDENL 162 AVE+Y +NW+ +A+ V RTH+QC QRWKK L+PGLVKG W+ EED+ L Sbjct: 109 AVEHYQGKNWKAIAEAVPGRTHVQCLQRWKKVLQPGLVKGHWTEEEDQKL 158
BLAST of mRNA_H-elongata_contig101863.161.1 vs. uniprot
Match: A0A7S3M1M2_9STRA (Hypothetical protein (Fragment) n=1 Tax=Spumella elongata TaxID=89044 RepID=A0A7S3M1M2_9STRA) HSP 1 Score: 70.9 bits (172), Expect = 3.070e-13 Identity = 28/51 (54.90%), Postives = 38/51 (74.51%), Query Frame = 1 Query: 10 QAVENYGDRNWRHVAQTVGTRTHIQCQQRWKKALRPGLVKGAWSLEEDENL 162 Q +E +GD +WR V++ VGTR ++CQQRW K LRP L+KG W+ EED+ L Sbjct: 11 QGIERFGDNDWRRVSEVVGTRDAVKCQQRWDKVLRPDLLKGKWTEEEDQRL 61
BLAST of mRNA_H-elongata_contig101863.161.1 vs. uniprot
Match: F0Y4V5_AURAN (Uncharacterized protein n=1 Tax=Aureococcus anophagefferens TaxID=44056 RepID=F0Y4V5_AURAN) HSP 1 Score: 71.2 bits (173), Expect = 4.100e-13 Identity = 29/50 (58.00%), Postives = 38/50 (76.00%), Query Frame = 1 Query: 13 AVENYGDRNWRHVAQTVGTRTHIQCQQRWKKALRPGLVKGAWSLEEDENL 162 AV+ +G+ NW+ +A VG+R H+QC QRWKK L+PGLVKG W+ EDE L Sbjct: 61 AVKQHGECNWKSIAAAVGSRNHMQCLQRWKKVLKPGLVKGNWTRSEDETL 110 The following BLAST results are available for this feature:
BLAST of mRNA_H-elongata_contig101863.161.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25 ZOOMx 1POSITION0
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-elongata_contig101863.161.1 >prot_H-elongata_contig101863.161.1 ID=prot_H-elongata_contig101863.161.1|Name=mRNA_H-elongata_contig101863.161.1|organism=Himanthalia elongata Himel1 dioecious|type=polypeptide|length=54bp MEWQAVENYGDRNWRHVAQTVGTRTHIQCQQRWKKALRPGLVKGAWSLEEback to top mRNA from alignment at H-elongata_contig101863:1713..1874+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-elongata_contig101863.161.1 ID=mRNA_H-elongata_contig101863.161.1|Name=mRNA_H-elongata_contig101863.161.1|organism=Himanthalia elongata Himel1 dioecious|type=mRNA|length=162bp|location=Sequence derived from alignment at H-elongata_contig101863:1713..1874+ (Himanthalia elongata Himel1 dioecious)back to top Coding sequence (CDS) from alignment at H-elongata_contig101863:1713..1874+ >mRNA_H-elongata_contig101863.161.1 ID=mRNA_H-elongata_contig101863.161.1|Name=mRNA_H-elongata_contig101863.161.1|organism=Himanthalia elongata Himel1 dioecious|type=CDS|length=324bp|location=Sequence derived from alignment at H-elongata_contig101863:1713..1874+ (Himanthalia elongata Himel1 dioecious)back to top |