mRNA_H-elongata_contig101102.100.1 (mRNA) Himanthalia elongata Himel1 dioecious
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_H-elongata_contig101102.100.1 vs. uniprot
Match: A0A6H5L8T9_9PHAE (Protein YIPF n=2 Tax=Ectocarpus TaxID=2879 RepID=A0A6H5L8T9_9PHAE) HSP 1 Score: 82.4 bits (202), Expect = 3.880e-17 Identity = 40/74 (54.05%), Postives = 49/74 (66.22%), Query Frame = 1 Query: 1 GQKISMCGMLSTEFYRPYFDVNTNEVKARLSQAAWPLRRTPLFLHTSNDDEGKSGSDGPKYPDLYGPVWVSVAL 222 G KISMCG+LS ++Y+PYFDV+T+EVK +L QA WP+R+T FL EG S DLYGPVWV L Sbjct: 92 GPKISMCGLLSLQYYQPYFDVDTSEVKTKLLQAIWPMRKTASFL-----GEGDSSK-----VDLYGPVWVPATL 155
BLAST of mRNA_H-elongata_contig101102.100.1 vs. uniprot
Match: G0R3I1_ICHMG (Protein YIPF n=1 Tax=Ichthyophthirius multifiliis (strain G5) TaxID=857967 RepID=G0R3I1_ICHMG) HSP 1 Score: 54.7 bits (130), Expect = 5.410e-7 Identity = 24/73 (32.88%), Postives = 39/73 (53.42%), Query Frame = 1 Query: 4 QKISMCGMLSTEFYRPYFDVNTNEVKARLSQAAWPLRRTPLFLHTSNDDEGKSGSDGPKYPDLYGPVWVSVAL 222 Q++ +CG L E+Y+PYF++ +NE+K R+ P++ P FL+ PDL+GP W+ L Sbjct: 57 QQLGICGFLQLEYYQPYFNITSNEIKQRVKSCFLPIK--PDFLNIIKQK-----------PDLWGPFWILTTL 116
BLAST of mRNA_H-elongata_contig101102.100.1 vs. uniprot
Match: A0A654HJ50_9CEST (Protein YIPF n=1 Tax=Sparganum proliferum TaxID=64606 RepID=A0A654HJ50_9CEST) HSP 1 Score: 50.4 bits (119), Expect = 2.060e-5 Identity = 22/62 (35.48%), Postives = 32/62 (51.61%), Query Frame = 1 Query: 37 EFYRPYFDVNTNEVKARLSQAAWPLRRTPLFLHTSNDDEGKSGSDGPKYPDLYGPVWVSVAL 222 +FY+ YFDV+TN+V RL + WP + ++ PDLYGP W++V L Sbjct: 40 DFYKSYFDVDTNQVLKRLCSSVWPFSKECSLYNSLQPT-----------PDLYGPFWITVTL 90
BLAST of mRNA_H-elongata_contig101102.100.1 vs. uniprot
Match: A0A7M3RM32_SPIER (Protein YIPF n=2 Tax=Spirometra erinaceieuropaei TaxID=99802 RepID=A0A7M3RM32_SPIER) HSP 1 Score: 50.4 bits (119), Expect = 2.070e-5 Identity = 24/62 (38.71%), Postives = 34/62 (54.84%), Query Frame = 1 Query: 37 EFYRPYFDVNTNEVKARLSQAAWPLRRTPLFLHTSNDDEGKSGSDGPKYPDLYGPVWVSVAL 222 +FY+ YFDV+TN+V RL + WP + L++S PDLYGP W++V L Sbjct: 45 DFYKSYFDVDTNQVLKRLCSSVWPFSKE-CSLYSSLQPT----------PDLYGPFWITVTL 95
BLAST of mRNA_H-elongata_contig101102.100.1 vs. uniprot
Match: A0A8J2SR10_9STRA (Protein YIPF n=1 Tax=Pelagomonas calceolata TaxID=35677 RepID=A0A8J2SR10_9STRA) HSP 1 Score: 48.9 bits (115), Expect = 5.750e-5 Identity = 28/68 (41.18%), Postives = 32/68 (47.06%), Query Frame = 1 Query: 19 CGMLSTEFYRPYFDVNTNEVKARLSQAAWPLRRTPLFLHTSNDDEGKSGSDGPKYPDLYGPVWVSVAL 222 C LS +YRPYFDV+T+EV ARL R LF G PD YGP WV+ L Sbjct: 29 CACLSVAYYRPYFDVDTDEVAARL--------RAALFFCNEPFGATLRGK-----PDAYGPWWVATTL 83 The following BLAST results are available for this feature:
BLAST of mRNA_H-elongata_contig101102.100.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 5 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-elongata_contig101102.100.1 >prot_H-elongata_contig101102.100.1 ID=prot_H-elongata_contig101102.100.1|Name=mRNA_H-elongata_contig101102.100.1|organism=Himanthalia elongata Himel1 dioecious|type=polypeptide|length=71bp MCGMLSTEFYRPYFDVNTNEVKARLSQAAWPLRRTPLFLHTSNDDEGKSGback to top mRNA from alignment at H-elongata_contig101102:2034..2261+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-elongata_contig101102.100.1 ID=mRNA_H-elongata_contig101102.100.1|Name=mRNA_H-elongata_contig101102.100.1|organism=Himanthalia elongata Himel1 dioecious|type=mRNA|length=228bp|location=Sequence derived from alignment at H-elongata_contig101102:2034..2261+ (Himanthalia elongata Himel1 dioecious)back to top Coding sequence (CDS) from alignment at H-elongata_contig101102:2034..2261+ >mRNA_H-elongata_contig101102.100.1 ID=mRNA_H-elongata_contig101102.100.1|Name=mRNA_H-elongata_contig101102.100.1|organism=Himanthalia elongata Himel1 dioecious|type=CDS|length=426bp|location=Sequence derived from alignment at H-elongata_contig101102:2034..2261+ (Himanthalia elongata Himel1 dioecious)back to top |