mRNA_H-elongata_contig101096.99.1 (mRNA) Himanthalia elongata Himel1 dioecious
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_H-elongata_contig101096.99.1 vs. uniprot
Match: A0A0U4D4N3_MELSA (Catalase n=1 Tax=Melanoplus sanguinipes TaxID=65742 RepID=A0A0U4D4N3_MELSA) HSP 1 Score: 72.8 bits (177), Expect = 1.910e-15 Identity = 33/35 (94.29%), Postives = 34/35 (97.14%), Query Frame = 1 Query: 22 QDYTLIDHLAHFDRERIPERVVHAKGAGAFGYFEV 126 QD+TLID LAHFDRERIPERVVHAKGAGAFGYFEV Sbjct: 52 QDFTLIDELAHFDRERIPERVVHAKGAGAFGYFEV 86
BLAST of mRNA_H-elongata_contig101096.99.1 vs. uniprot
Match: D7G1K9_ECTSI (Catalase n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G1K9_ECTSI) HSP 1 Score: 77.4 bits (189), Expect = 2.240e-15 Identity = 35/35 (100.00%), Postives = 35/35 (100.00%), Query Frame = 1 Query: 22 QDYTLIDHLAHFDRERIPERVVHAKGAGAFGYFEV 126 QDYTLIDHLAHFDRERIPERVVHAKGAGAFGYFEV Sbjct: 49 QDYTLIDHLAHFDRERIPERVVHAKGAGAFGYFEV 83
BLAST of mRNA_H-elongata_contig101096.99.1 vs. uniprot
Match: A0A662YAE1_9STRA (Catalase n=2 Tax=Nothophytophthora sp. Chile5 TaxID=2483409 RepID=A0A662YAE1_9STRA) HSP 1 Score: 76.3 bits (186), Expect = 5.680e-15 Identity = 35/40 (87.50%), Postives = 37/40 (92.50%), Query Frame = 1 Query: 22 QDYTLIDHLAHFDRERIPERVVHAKGAGAFGYFEVWPHNT 141 QD+ L+DHLAHFDRERIPERVVHAKGAGAFGYFEV HNT Sbjct: 37 QDFALLDHLAHFDRERIPERVVHAKGAGAFGYFEV-THNT 75
BLAST of mRNA_H-elongata_contig101096.99.1 vs. uniprot
Match: G5AI36_PHYSP (Catalase domain-containing protein n=1 Tax=Phytophthora sojae (strain P6497) TaxID=1094619 RepID=G5AI36_PHYSP) HSP 1 Score: 73.9 bits (180), Expect = 1.230e-14 Identity = 34/40 (85.00%), Postives = 36/40 (90.00%), Query Frame = 1 Query: 22 QDYTLIDHLAHFDRERIPERVVHAKGAGAFGYFEVWPHNT 141 QD+ L+DHLAHFDRERIPERVVHAKGAGAFGYFEV H T Sbjct: 37 QDFALLDHLAHFDRERIPERVVHAKGAGAFGYFEV-THET 75
BLAST of mRNA_H-elongata_contig101096.99.1 vs. uniprot
Match: A0A5D6Y7E2_9STRA (Catalase n=1 Tax=Pythium brassicum TaxID=1485010 RepID=A0A5D6Y7E2_9STRA) HSP 1 Score: 74.7 bits (182), Expect = 1.970e-14 Identity = 34/41 (82.93%), Postives = 35/41 (85.37%), Query Frame = 1 Query: 22 QDYTLIDHLAHFDRERIPERVVHAKGAGAFGYFEVWPHNTL 144 QD+ LIDHLAHFDRERIPERVVHAKGAGAFGYFEV L Sbjct: 36 QDFALIDHLAHFDRERIPERVVHAKGAGAFGYFEVTHSENL 76
BLAST of mRNA_H-elongata_contig101096.99.1 vs. uniprot
Match: A0A2D4C1S8_PYTIN (Catalase n=2 Tax=Pythium insidiosum TaxID=114742 RepID=A0A2D4C1S8_PYTIN) HSP 1 Score: 74.3 bits (181), Expect = 2.720e-14 Identity = 33/41 (80.49%), Postives = 36/41 (87.80%), Query Frame = 1 Query: 22 QDYTLIDHLAHFDRERIPERVVHAKGAGAFGYFEVWPHNTL 144 QD+ LIDHLAHFDRERIPERVVHAKGAGAFGYFEV + + Sbjct: 44 QDFALIDHLAHFDRERIPERVVHAKGAGAFGYFEVTHSDAI 84
BLAST of mRNA_H-elongata_contig101096.99.1 vs. uniprot
Match: K3X6S3_GLOUD (Catalase n=1 Tax=Globisporangium ultimum (strain ATCC 200006 / CBS 805.95 / DAOM BR144) TaxID=431595 RepID=K3X6S3_GLOUD) HSP 1 Score: 73.9 bits (180), Expect = 3.710e-14 Identity = 33/35 (94.29%), Postives = 34/35 (97.14%), Query Frame = 1 Query: 22 QDYTLIDHLAHFDRERIPERVVHAKGAGAFGYFEV 126 QD+ LIDHLAHFDRERIPERVVHAKGAGAFGYFEV Sbjct: 35 QDFALIDHLAHFDRERIPERVVHAKGAGAFGYFEV 69
BLAST of mRNA_H-elongata_contig101096.99.1 vs. uniprot
Match: G4ZJB4_PHYSP (Catalase n=1 Tax=Phytophthora sojae (strain P6497) TaxID=1094619 RepID=G4ZJB4_PHYSP) HSP 1 Score: 73.9 bits (180), Expect = 3.720e-14 Identity = 34/40 (85.00%), Postives = 36/40 (90.00%), Query Frame = 1 Query: 22 QDYTLIDHLAHFDRERIPERVVHAKGAGAFGYFEVWPHNT 141 QD+ L+DHLAHFDRERIPERVVHAKGAGAFGYFEV H T Sbjct: 151 QDFALLDHLAHFDRERIPERVVHAKGAGAFGYFEV-THET 189
BLAST of mRNA_H-elongata_contig101096.99.1 vs. uniprot
Match: B3SC13_TRIAD (Catalase n=1 Tax=Trichoplax adhaerens TaxID=10228 RepID=B3SC13_TRIAD) HSP 1 Score: 73.6 bits (179), Expect = 5.060e-14 Identity = 33/35 (94.29%), Postives = 34/35 (97.14%), Query Frame = 1 Query: 22 QDYTLIDHLAHFDRERIPERVVHAKGAGAFGYFEV 126 QD TLIDH+AHFDRERIPERVVHAKGAGAFGYFEV Sbjct: 51 QDITLIDHMAHFDRERIPERVVHAKGAGAFGYFEV 85
BLAST of mRNA_H-elongata_contig101096.99.1 vs. uniprot
Match: W2QRP3_PHYPN (Catalase n=12 Tax=Phytophthora TaxID=4783 RepID=W2QRP3_PHYPN) HSP 1 Score: 73.6 bits (179), Expect = 5.060e-14 Identity = 34/40 (85.00%), Postives = 37/40 (92.50%), Query Frame = 1 Query: 22 QDYTLIDHLAHFDRERIPERVVHAKGAGAFGYFEVWPHNT 141 QD+ LIDHLAHFDRERIPERVVHAKGAGAFG+FEV H+T Sbjct: 37 QDFALIDHLAHFDRERIPERVVHAKGAGAFGFFEV-THDT 75 The following BLAST results are available for this feature:
BLAST of mRNA_H-elongata_contig101096.99.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25 ZOOMx 1POSITION0
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-elongata_contig101096.99.1 >prot_H-elongata_contig101096.99.1 ID=prot_H-elongata_contig101096.99.1|Name=mRNA_H-elongata_contig101096.99.1|organism=Himanthalia elongata Himel1 dioecious|type=polypeptide|length=49bp MCVLGGRQDYTLIDHLAHFDRERIPERVVHAKGAGAFGYFEVWPHNTL*back to top mRNA from alignment at H-elongata_contig101096:2103..2249+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-elongata_contig101096.99.1 ID=mRNA_H-elongata_contig101096.99.1|Name=mRNA_H-elongata_contig101096.99.1|organism=Himanthalia elongata Himel1 dioecious|type=mRNA|length=147bp|location=Sequence derived from alignment at H-elongata_contig101096:2103..2249+ (Himanthalia elongata Himel1 dioecious)back to top Coding sequence (CDS) from alignment at H-elongata_contig101096:2103..2249+ >mRNA_H-elongata_contig101096.99.1 ID=mRNA_H-elongata_contig101096.99.1|Name=mRNA_H-elongata_contig101096.99.1|organism=Himanthalia elongata Himel1 dioecious|type=CDS|length=294bp|location=Sequence derived from alignment at H-elongata_contig101096:2103..2249+ (Himanthalia elongata Himel1 dioecious)back to top |