mRNA_H-elongata_contig100944.86.1 (mRNA) Himanthalia elongata Himel1 dioecious
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_H-elongata_contig100944.86.1 vs. uniprot
Match: A0A6H5KVW8_9PHAE (Zn(2)-C6 fungal-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KVW8_9PHAE) HSP 1 Score: 86.3 bits (212), Expect = 4.110e-18 Identity = 41/59 (69.49%), Postives = 46/59 (77.97%), Query Frame = 1 Query: 31 RHWALCALDRRSKKLMHKTVEMAKALCINVMEVLNDYGIYAMFHELLREAGKSIRLSPL 207 RHWALCALDRRS LM +TV MA+AL INV E+LNDY IYAMFHELLREA + P+ Sbjct: 631 RHWALCALDRRSTHLMRETVSMARALSINVAEILNDYSIYAMFHELLREAEAGNTIEPV 689
BLAST of mRNA_H-elongata_contig100944.86.1 vs. uniprot
Match: D7FVP7_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FVP7_ECTSI) HSP 1 Score: 86.3 bits (212), Expect = 4.110e-18 Identity = 41/59 (69.49%), Postives = 46/59 (77.97%), Query Frame = 1 Query: 31 RHWALCALDRRSKKLMHKTVEMAKALCINVMEVLNDYGIYAMFHELLREAGKSIRLSPL 207 RHWALCALDRRS LM +TV MA+AL INV E+LNDY IYAMFHELLREA + P+ Sbjct: 582 RHWALCALDRRSTHLMRETVSMARALSINVAEILNDYSIYAMFHELLREAEAGNTIEPV 640 The following BLAST results are available for this feature:
BLAST of mRNA_H-elongata_contig100944.86.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-elongata_contig100944.86.1 >prot_H-elongata_contig100944.86.1 ID=prot_H-elongata_contig100944.86.1|Name=mRNA_H-elongata_contig100944.86.1|organism=Himanthalia elongata Himel1 dioecious|type=polypeptide|length=69bp MVLLSISARSRHWALCALDRRSKKLMHKTVEMAKALCINVMEVLNDYGIYback to top mRNA from alignment at H-elongata_contig100944:205..1148- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-elongata_contig100944.86.1 ID=mRNA_H-elongata_contig100944.86.1|Name=mRNA_H-elongata_contig100944.86.1|organism=Himanthalia elongata Himel1 dioecious|type=mRNA|length=944bp|location=Sequence derived from alignment at H-elongata_contig100944:205..1148- (Himanthalia elongata Himel1 dioecious)back to top Coding sequence (CDS) from alignment at H-elongata_contig100944:205..1148- >mRNA_H-elongata_contig100944.86.1 ID=mRNA_H-elongata_contig100944.86.1|Name=mRNA_H-elongata_contig100944.86.1|organism=Himanthalia elongata Himel1 dioecious|type=CDS|length=414bp|location=Sequence derived from alignment at H-elongata_contig100944:205..1148- (Himanthalia elongata Himel1 dioecious)back to top |