mRNA_H-elongata_contig100808.74.1 (mRNA) Himanthalia elongata Himel1 dioecious
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_H-elongata_contig100808.74.1 vs. uniprot
Match: D7FP16_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FP16_ECTSI) HSP 1 Score: 94.0 bits (232), Expect = 1.090e-20 Identity = 50/74 (67.57%), Postives = 60/74 (81.08%), Query Frame = 1 Query: 1 VKNFLTVPRQLEKLLLFGMLVCLDTFLYVTTFLPIRIIIGVVSALFSLVTRWAPGGFVQLWVKIIYEPLRGGVF 222 V+NFLTVPRQLE+LLLFGMLVCLDTFLYVTTFLPIRI+IGVVS+LFSL+TR + ++Y+ +RG F Sbjct: 676 VRNFLTVPRQLERLLLFGMLVCLDTFLYVTTFLPIRIVIGVVSSLFSLLTRRRRPSVNR---PLVYDWMRGATF 746
BLAST of mRNA_H-elongata_contig100808.74.1 vs. uniprot
Match: A0A6H5KXP0_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KXP0_9PHAE) HSP 1 Score: 91.3 bits (225), Expect = 9.500e-20 Identity = 46/51 (90.20%), Postives = 51/51 (100.00%), Query Frame = 1 Query: 1 VKNFLTVPRQLEKLLLFGMLVCLDTFLYVTTFLPIRIIIGVVSALFSLVTR 153 V+NFLTVPRQLE+LLLFGMLVCLDTFLYVTTFLPIRI+IGVVS+LFSL+TR Sbjct: 633 VRNFLTVPRQLERLLLFGMLVCLDTFLYVTTFLPIRIVIGVVSSLFSLLTR 683
BLAST of mRNA_H-elongata_contig100808.74.1 vs. uniprot
Match: A0A8J4Q240_9MYCE (Uncharacterized protein n=1 Tax=Polysphondylium violaceum TaxID=133409 RepID=A0A8J4Q240_9MYCE) HSP 1 Score: 56.6 bits (135), Expect = 1.480e-7 Identity = 31/70 (44.29%), Postives = 44/70 (62.86%), Query Frame = 1 Query: 1 VKNFLTVPRQLEKLLLFGMLVCLDTFLYVTTFLPIRIIIGVVSALFSLVTRWAPGGFVQLWVKIIYEPLR 210 V NF+ VP +LEKL++FG VC D+FLY+ TFLPIRI+I + S++ R G + + +IY L Sbjct: 281 VYNFVHVPIELEKLIIFGFFVCFDSFLYLFTFLPIRIVIAIYSSMLYHYIR----GQAVIKLYVIYNVLE 346
BLAST of mRNA_H-elongata_contig100808.74.1 vs. uniprot
Match: UPI00106B1B2F (transmembrane anterior posterior transformation protein 1 homolog n=1 Tax=Dendronephthya gigantea TaxID=151771 RepID=UPI00106B1B2F) HSP 1 Score: 56.6 bits (135), Expect = 1.480e-7 Identity = 31/76 (40.79%), Postives = 49/76 (64.47%), Query Frame = 1 Query: 1 VKNFLTVPRQLEKLLLFGMLVCLDTFLYVTTFLPIRIIIGVVSALFSLVT-RWAPGGFVQLWVKIIYEPLRGGVFL 225 V F+ PR+LEKL+ FG L+CLD FL+V T+LP+R+++ V+ L +++ ++ GF L I + LRG + L Sbjct: 219 VYTFMKTPRELEKLMWFGFLLCLDCFLFVFTYLPVRVLLAVLKLLGNVICLKFLRRGFSLLESHQICDLLRGLILL 294
BLAST of mRNA_H-elongata_contig100808.74.1 vs. uniprot
Match: A0A1Y2AQA9_9FUNG (DUF747-domain-containing protein n=1 Tax=Neocallimastix californiae TaxID=1754190 RepID=A0A1Y2AQA9_9FUNG) HSP 1 Score: 56.2 bits (134), Expect = 2.050e-7 Identity = 26/51 (50.98%), Postives = 38/51 (74.51%), Query Frame = 1 Query: 1 VKNFLTVPRQLEKLLLFGMLVCLDTFLYVTTFLPIRIIIGVVSALFSLVTR 153 V+NFL VP +LEK L +G+L+CLD+FLY+ T LPIR+++ V S + L + Sbjct: 410 VQNFLAVPVELEKFLYYGILICLDSFLYIFTILPIRLVVAVKSMIKGLFVK 460
BLAST of mRNA_H-elongata_contig100808.74.1 vs. uniprot
Match: A0A1Y1XAV7_9FUNG (DUF747-domain-containing protein n=1 Tax=Anaeromyces robustus TaxID=1754192 RepID=A0A1Y1XAV7_9FUNG) HSP 1 Score: 55.8 bits (133), Expect = 2.790e-7 Identity = 26/51 (50.98%), Postives = 38/51 (74.51%), Query Frame = 1 Query: 1 VKNFLTVPRQLEKLLLFGMLVCLDTFLYVTTFLPIRIIIGVVSALFSLVTR 153 ++NFL VP +LEK L +G+L+CLD+FLY+ T LPIR+I+ V S + L + Sbjct: 355 IQNFLAVPVELEKFLNYGILICLDSFLYIFTILPIRLIVAVFSMIKGLFVK 405
BLAST of mRNA_H-elongata_contig100808.74.1 vs. uniprot
Match: A0A109FBV4_9BASI (DUF747-domain-containing protein (Fragment) n=1 Tax=Rhodotorula sp. JG-1b TaxID=1305733 RepID=A0A109FBV4_9BASI) HSP 1 Score: 55.5 bits (132), Expect = 3.720e-7 Identity = 24/40 (60.00%), Postives = 32/40 (80.00%), Query Frame = 1 Query: 1 VKNFLTVPRQLEKLLLFGMLVCLDTFLYVTTFLPIRIIIG 120 V NFLTVPR+LEK+++FG VCLD+FLY T LP+R ++ Sbjct: 28 VTNFLTVPRELEKIIMFGSFVCLDSFLYTFTILPLRAVVA 67
BLAST of mRNA_H-elongata_contig100808.74.1 vs. uniprot
Match: A0A1Y2FJ93_9FUNG (DUF747-domain-containing protein n=1 Tax=Neocallimastix californiae TaxID=1754190 RepID=A0A1Y2FJ93_9FUNG) HSP 1 Score: 55.5 bits (132), Expect = 3.780e-7 Identity = 26/51 (50.98%), Postives = 38/51 (74.51%), Query Frame = 1 Query: 1 VKNFLTVPRQLEKLLLFGMLVCLDTFLYVTTFLPIRIIIGVVSALFSLVTR 153 V+NFL VP +LEK L +G+L+CLD+FLY+ T LPIR+++ V S + L + Sbjct: 222 VQNFLAVPVELEKFLNYGILICLDSFLYIFTILPIRLVVAVKSMIKGLFVK 272
BLAST of mRNA_H-elongata_contig100808.74.1 vs. uniprot
Match: A0A507DCX2_9FUNG (Uncharacterized protein n=1 Tax=Synchytrium endobioticum TaxID=286115 RepID=A0A507DCX2_9FUNG) HSP 1 Score: 55.5 bits (132), Expect = 3.810e-7 Identity = 26/51 (50.98%), Postives = 39/51 (76.47%), Query Frame = 1 Query: 1 VKNFLTVPRQLEKLLLFGMLVCLDTFLYVTTFLPIRIIIGVVSALFSLVTR 153 V+NFL+VP++LEK +LFG +CLD+FLY+ T LP+RI I + + + +L R Sbjct: 353 VQNFLSVPQELEKFMLFGYSICLDSFLYIFTILPLRICIALFALIRALFIR 403
BLAST of mRNA_H-elongata_contig100808.74.1 vs. uniprot
Match: A0A1Y3N6M4_PIRSE (Uncharacterized protein n=1 Tax=Piromyces sp. (strain E2) TaxID=73868 RepID=A0A1Y3N6M4_PIRSE) HSP 1 Score: 55.1 bits (131), Expect = 5.010e-7 Identity = 27/51 (52.94%), Postives = 37/51 (72.55%), Query Frame = 1 Query: 1 VKNFLTVPRQLEKLLLFGMLVCLDTFLYVTTFLPIRIIIGVVSALFSLVTR 153 ++NFL VP +LEK L +G+L+CLD+FLY T LPIR+II V S + L + Sbjct: 48 IQNFLAVPVELEKFLNYGILICLDSFLYTFTILPIRLIIAVFSMIKGLFVK 98 The following BLAST results are available for this feature:
BLAST of mRNA_H-elongata_contig100808.74.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25 ZOOMx 1POSITION0
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-elongata_contig100808.74.1 >prot_H-elongata_contig100808.74.1 ID=prot_H-elongata_contig100808.74.1|Name=mRNA_H-elongata_contig100808.74.1|organism=Himanthalia elongata Himel1 dioecious|type=polypeptide|length=76bp VKNFLTVPRQLEKLLLFGMLVCLDTFLYVTTFLPIRIIIGVVSALFSLVTback to top mRNA from alignment at H-elongata_contig100808:203..430- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-elongata_contig100808.74.1 ID=mRNA_H-elongata_contig100808.74.1|Name=mRNA_H-elongata_contig100808.74.1|organism=Himanthalia elongata Himel1 dioecious|type=mRNA|length=228bp|location=Sequence derived from alignment at H-elongata_contig100808:203..430- (Himanthalia elongata Himel1 dioecious)back to top Coding sequence (CDS) from alignment at H-elongata_contig100808:203..430- >mRNA_H-elongata_contig100808.74.1 ID=mRNA_H-elongata_contig100808.74.1|Name=mRNA_H-elongata_contig100808.74.1|organism=Himanthalia elongata Himel1 dioecious|type=CDS|length=456bp|location=Sequence derived from alignment at H-elongata_contig100808:203..430- (Himanthalia elongata Himel1 dioecious)back to top |