prot_H-akashiwo_Contig1028.4.1 (polypeptide) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig1028.4.1 vs. uniprot
Match: A0A7S3Y5V7_HETAK (Hypothetical protein (Fragment) n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S3Y5V7_HETAK) HSP 1 Score: 132 bits (332), Expect = 3.060e-34 Identity = 60/60 (100.00%), Postives = 60/60 (100.00%), Query Frame = 0 Query: 24 PHDPYLYLVHLVDRLEAQPSYDYSFHRTLISICTIACYPDHLAPEMETSEDLFLLFRKAW 83 PHDPYLYLVHLVDRLEAQPSYDYSFHRTLISICTIACYPDHLAPEMETSEDLFLLFRKAW Sbjct: 500 PHDPYLYLVHLVDRLEAQPSYDYSFHRTLISICTIACYPDHLAPEMETSEDLFLLFRKAW 559
BLAST of mRNA_H-akashiwo_Contig1028.4.1 vs. uniprot
Match: A0A7S4DCM9_HETAK (Hypothetical protein (Fragment) n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S4DCM9_HETAK) HSP 1 Score: 120 bits (301), Expect = 4.640e-32 Identity = 51/60 (85.00%), Postives = 58/60 (96.67%), Query Frame = 0 Query: 24 PHDPYLYLVHLVDRLEAQPSYDYSFHRTLISICTIACYPDHLAPEMETSEDLFLLFRKAW 83 PHDPYLYLVHLVD LEAQPSYDYSFH TLIS+C+IACYPDH+AP+METS+DL++LFRKAW Sbjct: 78 PHDPYLYLVHLVDCLEAQPSYDYSFHHTLISVCSIACYPDHIAPDMETSQDLYMLFRKAW 137 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig1028.4.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-akashiwo_Contig1028.4.1 ID=prot_H-akashiwo_Contig1028.4.1|Name=mRNA_H-akashiwo_Contig1028.4.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=83bpback to top |