prot_H-akashiwo_Contig98.11.1 (polypeptide) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig98.11.1 vs. uniprot
Match: UPI001CBBD3D3 (EF-hand domain-containing protein n=1 Tax=Kangiella taiwanensis TaxID=1079179 RepID=UPI001CBBD3D3) HSP 1 Score: 57.8 bits (138), Expect = 8.090e-9 Identity = 26/63 (41.27%), Postives = 40/63 (63.49%), Query Frame = 0 Query: 22 QIQAIYNDLDVNGDNQVTIIEFGELLEELGKELTPEEVAHAFRLLDTDASDYIEFREFLAWWR 84 +I+ +N D + + ++ + EFGELL+ L + E++ F L+DTD S YIEF EFL WW+ Sbjct: 11 EIKEHFNFFDRDNNGRIDVDEFGELLQVLSPDAGDEQIHKGFSLVDTDGSGYIEFEEFLTWWK 73
BLAST of mRNA_H-akashiwo_Contig98.11.1 vs. uniprot
Match: A0A1B3BAD4_9GAMM (Putative signal transduction protein with EFhand domain n=2 Tax=Kangiella sediminilitoris TaxID=1144748 RepID=A0A1B3BAD4_9GAMM) HSP 1 Score: 56.6 bits (135), Expect = 2.290e-8 Identity = 26/63 (41.27%), Postives = 40/63 (63.49%), Query Frame = 0 Query: 22 QIQAIYNDLDVNGDNQVTIIEFGELLEELGKELTPEEVAHAFRLLDTDASDYIEFREFLAWWR 84 +I+ ++ D +G+ ++ + EF ELL L E P++ F L+DTD S YIEF EFL+WW+ Sbjct: 11 EIKGHFDFFDSDGNGRIDLDEFTELLVVLSPESNPDQAQEGFALIDTDRSGYIEFDEFLSWWK 73
BLAST of mRNA_H-akashiwo_Contig98.11.1 vs. uniprot
Match: UPI001CBCC680 (EF-hand domain-containing protein n=1 Tax=Kangiella shandongensis TaxID=2763258 RepID=UPI001CBCC680) HSP 1 Score: 55.5 bits (132), Expect = 6.460e-8 Identity = 30/72 (41.67%), Postives = 43/72 (59.72%), Query Frame = 0 Query: 18 FSDEQIQAIYN-----DLDVNGDNQVTIIEFGELLEELGKELTPEEVAHAFRLLDTDASDYIEFREFLAWWR 84 +D+Q++ I N D D NG ++ + EF ELL L + PE+ F L+DT+ S YIEF EFL+WW+ Sbjct: 4 LTDKQLEEIQNHFKFFDRDNNG--RIDLEEFAELLAVLSPDSNPEQAKEGFSLIDTNGSGYIEFDEFLSWWK 73
BLAST of mRNA_H-akashiwo_Contig98.11.1 vs. uniprot
Match: D8UDD2_VOLCA (Uncharacterized protein n=1 Tax=Volvox carteri f. nagariensis TaxID=3068 RepID=D8UDD2_VOLCA) HSP 1 Score: 58.2 bits (139), Expect = 1.430e-7 Identity = 26/66 (39.39%), Postives = 43/66 (65.15%), Query Frame = 0 Query: 22 QIQAIYNDLDVNGDNQVTIIEFGELLEELGKELTPEEVAHAFRLLDTDASDYIEFREFLAWWRREK 87 +I +++ DVN D ++ + E +L ++LGKELT +E+ A R+LDT + ++E EF AWW + K Sbjct: 289 EIAYVFSTYDVNDDYRLELSEVKKLCQDLGKELTEDELKEAMRILDTSKNGFVELDEFCAWWTKAK 354
BLAST of mRNA_H-akashiwo_Contig98.11.1 vs. uniprot
Match: A0A8J4C5P0_9CHLO (Uncharacterized protein n=2 Tax=Volvox TaxID=3066 RepID=A0A8J4C5P0_9CHLO) HSP 1 Score: 56.6 bits (135), Expect = 4.900e-7 Identity = 25/66 (37.88%), Postives = 42/66 (63.64%), Query Frame = 0 Query: 22 QIQAIYNDLDVNGDNQVTIIEFGELLEELGKELTPEEVAHAFRLLDTDASDYIEFREFLAWWRREK 87 +I +++ DVN D ++ + E L ++LGK+LT +E+ A R+LDT + ++E EF AWW + K Sbjct: 274 EIAYVFSTYDVNDDYRLELSEVKRLCQDLGKDLTDDELKEALRILDTSKNGFVELDEFCAWWTKTK 339
BLAST of mRNA_H-akashiwo_Contig98.11.1 vs. uniprot
Match: UPI000424B726 (EF-hand domain-containing protein n=1 Tax=Rheinheimera baltica TaxID=67576 RepID=UPI000424B726) HSP 1 Score: 48.5 bits (114), Expect = 3.370e-5 Identity = 26/70 (37.14%), Postives = 39/70 (55.71%), Query Frame = 0 Query: 18 FSDEQIQAIYNDLDV---NGDNQVTIIEFGELLEELGKELTPEEVAHAFRLLDTDASDYIEFREFLAWWR 84 S++Q+ AI +D D +G+ Q+ I EF ELL L + V F+L+DT+ + F EFL WW+ Sbjct: 6 LSEQQLAAIKSDFDFFDRDGNGQIDIAEFIELLTALAPKTKVSHVDEGFKLIDTNNDGFXXFAEFLTWWQ 75
BLAST of mRNA_H-akashiwo_Contig98.11.1 vs. uniprot
Match: A0A4R5HG83_9ALTE (EF-hand domain-containing protein n=1 Tax=Alteromonadaceae bacterium M269 TaxID=2546219 RepID=A0A4R5HG83_9ALTE) HSP 1 Score: 48.5 bits (114), Expect = 3.440e-5 Identity = 26/64 (40.62%), Postives = 38/64 (59.38%), Query Frame = 0 Query: 21 EQIQAIYNDLDVNGDNQVTIIEFGELLEELGKELTPEEVAHAFRLLDTDASDYIEFREFLAWWR 84 EQI+ + D +G+ Q+ + EF ELL L + + V AF L+DT+ +IEF EF AWW+ Sbjct: 13 EQIREEFAFFDQDGNGQIDMGEFIELLTVLSPKTKAKVVEEAFALIDTNQDGFIEFDEFAAWWQ 76 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig98.11.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 7
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-akashiwo_Contig98.11.1 ID=prot_H-akashiwo_Contig98.11.1|Name=mRNA_H-akashiwo_Contig98.11.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=112bpback to top |