mRNA_H-akashiwo_Contig966.3.1 (mRNA) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig966.3.1 vs. uniprot
Match: A0A7S1YRX3_9STRA (Hypothetical protein n=2 Tax=Ditylum brightwellii TaxID=49249 RepID=A0A7S1YRX3_9STRA) HSP 1 Score: 72.0 bits (175), Expect = 4.350e-13 Identity = 44/103 (42.72%), Postives = 57/103 (55.34%), Query Frame = 1 Query: 67 LLQSSIGEEGSAGWQQ-GEAMPKTIVLCDLSEP--------------------------PAELPPFPVEFAEVEELDLSGNGLESLPP-LAVLQKLKRLYLGG 291 +LQ IGE GSA W Q G+ +PKT++LCDLS+ A LPPFP EF+ +EELDLSGN L+S+P + L L+ L+LGG Sbjct: 3 MLQPPIGELGSANWDQVGDPIPKTLILCDLSDDCLSLLTTKHEGSKEDRNFSECTLLTASAVLPPFPEEFSIIEELDLSGNALDSIPDNINNLTNLRSLFLGG 105 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig966.3.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-akashiwo_Contig966.3.1 >prot_H-akashiwo_Contig966.3.1 ID=prot_H-akashiwo_Contig966.3.1|Name=mRNA_H-akashiwo_Contig966.3.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=99bp MDLVWISLLSRARSGSHSLLQSSIGEEGSAGWQQGEAMPKTIVLCDLSEPback to top mRNA from alignment at H-akashiwo_Contig966:111005..111313+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-akashiwo_Contig966.3.1 ID=mRNA_H-akashiwo_Contig966.3.1|Name=mRNA_H-akashiwo_Contig966.3.1|organism=Heterosigma akashiwo CCMP452|type=mRNA|length=309bp|location=Sequence derived from alignment at H-akashiwo_Contig966:111005..111313+ (Heterosigma akashiwo CCMP452)back to top Coding sequence (CDS) from alignment at H-akashiwo_Contig966:111005..111313+ >mRNA_H-akashiwo_Contig966.3.1 ID=mRNA_H-akashiwo_Contig966.3.1|Name=mRNA_H-akashiwo_Contig966.3.1|organism=Heterosigma akashiwo CCMP452|type=CDS|length=297bp|location=Sequence derived from alignment at H-akashiwo_Contig966:111005..111313+ (Heterosigma akashiwo CCMP452)back to top |