mRNA_H-akashiwo_Contig964.10.1 (mRNA) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig964.10.1 vs. uniprot
Match: A0A7S2V4J0_9STRA (Hypothetical protein (Fragment) n=1 Tax=Fibrocapsa japonica TaxID=94617 RepID=A0A7S2V4J0_9STRA) HSP 1 Score: 53.9 bits (128), Expect = 7.650e-7 Identity = 28/62 (45.16%), Postives = 46/62 (74.19%), Query Frame = 2 Query: 2 IIQLYLRMLLTFLGSCICTTLLACLKMTIGASIPLYVIFLPLFIGHVIAIGIYIYLSQTLYS 187 ++QL+LR+LL LG+ I T L L+ T ++IPL+VIF+P++ GH++++GIY+ L + LY Sbjct: 29 LVQLHLRILLALLGTFIVTMTLLILQFTWLSAIPLFVIFIPVWCGHILSVGIYVELCRRLYK 90 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig964.10.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-akashiwo_Contig964.10.1 >prot_H-akashiwo_Contig964.10.1 ID=prot_H-akashiwo_Contig964.10.1|Name=mRNA_H-akashiwo_Contig964.10.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=64bp DNTAVPADAFDISWVMYLHNLTGLSKNDNRGVHSIICDFPATFYWPRHCNback to top mRNA from alignment at H-akashiwo_Contig964:351191..351546+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-akashiwo_Contig964.10.1 ID=mRNA_H-akashiwo_Contig964.10.1|Name=mRNA_H-akashiwo_Contig964.10.1|organism=Heterosigma akashiwo CCMP452|type=mRNA|length=356bp|location=Sequence derived from alignment at H-akashiwo_Contig964:351191..351546+ (Heterosigma akashiwo CCMP452)back to top Coding sequence (CDS) from alignment at H-akashiwo_Contig964:351191..351546+ >mRNA_H-akashiwo_Contig964.10.1 ID=mRNA_H-akashiwo_Contig964.10.1|Name=mRNA_H-akashiwo_Contig964.10.1|organism=Heterosigma akashiwo CCMP452|type=CDS|length=192bp|location=Sequence derived from alignment at H-akashiwo_Contig964:351191..351546+ (Heterosigma akashiwo CCMP452)back to top |